Recombinant Mouse Nogo-66 Receptor, Reticulon 4 Receptor, NgR, RTN4R (C-Fc)

Contact us
Catalog number: CM16
Price: 591 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Mouse Nogo-66 Receptor, Reticulon 4 Receptor, NgR, RTN4R (C-Fc)
Quantity: 0.2 mg
Other quantities: 1 mg 1877€ 10 µg 126€ 500 µg 1328€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse NgR is produced by our Mammalian expression system and the target gene encoding Cys27-Ser447 is expressed with a Fc tag at the C-terminus
Molecular Weight: 7 kD, 72
UniProt number: Q99PI8
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: CPGACVCYNEPKVTTSCPQQGLQAVPTGIPASSQRIFLHGNRISHVPAASFQSCRNLTILWLHSNALARIDAAAFTGLTLLEQLDLSDNAQLHVVDPTTFHGLGHLHTLHLDRCGLRELGPGLFRGLAALQYLYLQDNNLQALPDNTFRDLGNLTHLFLHGNRIPSVPEHAFRGLHSLDRLLLHQNHVARVHPHAFRDLGRLMTLYLFANNLSMLPAEVLMPLRSLQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCNLPQRLADRDLKRLAASDLEGCAVASGPFRPIQTSQLTDEELLSLPKCCQPDAADKASVLEPGRPASAGNALKGRVPPGDTPPGNGSGPRHINDSPFGTLPSSAEPPLTALRPGGSEPPGLPTTGPRRRPGCSRKNRTRSHCRLGQAGSGASGTGDAEGSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: NgR, RTN4R (C-Fc), Reticulon 4 Receptor, Nogo-66 Receptor
Short name: NgR, RTN4R (C-Fc), Reticulon 4 Receptor, Recombinant Mouse Nogo-66 Receptor
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: NgR, RTN4R (C-fragment c), Reticulon 4 Receptor, recombinant Mouse Nogo-66 Receptor
Alternative technique: rec
Identity: 18601
Gene: RTN4R | More about : RTN4R
Long gene name: reticulon 4 receptor
Synonyms: NOGOR
Locus: 22q11, 21
Discovery year: 2002-04-30
GenBank acession: AF283463
Entrez gene record: 65078
Pubmed identfication: 11201742
Havana BLAST/BLAT: OTTHUMG00000150572

Related Products :

CM42 Recombinant Mouse Nogo-66 Receptor, Reticulon 4 Receptor, NgR, RTN4R (C-6His) 10 µg 126 € novo mouse
CM16 Recombinant Mouse Nogo-66 Receptor, Reticulon 4 Receptor, NgR, RTN4R (C-Fc) 500 µg 1328 € novo mouse
C632 Recombinant Human Nogo-66 Receptor, Reticulon 4 Receptor, NgR, RTN4R (C-6His) 1 mg 2283 € novo human
MBS616081 Nogo 66 Receptor (Ngr, Nogor, Reticulon 4 Receptor, Rtn4r, UNQ330/PRO526) Antibody 100ug 735 € MBS Polyclonals_1 human
RP-1427M Recombinant Mouse Nogo Receptor / NOGOR / RTN4R Protein (His & Fc Tag) 50μg 624 € adv mouse
RP-1428M Recombinant Mouse Nogo Receptor / NOGOR / RTN4R Protein (His Tag) 50μg 624 € adv mouse
RP-1134H Recombinant Human Nogo Receptor / NOGOR / RTN4R Protein (His & Fc Tag) 50μg 624 € adv human
RP-1133H Recombinant Human Nogo Receptor / NOGOR / RTN4R Protein (His Tag) 50μg 624 € adv human
GWB-B7DC60 Nogo Receptor (NOGOR) (RTN4R) Rabbit antibody to or anti-Human Polyclonal (aa50-100) antibody 1 vial 602 € genways human
CG56 Recombinant Human Nogo-A, Reticulon-4, RTN4 (N-GST) 1 mg 2283 € novo human
MBS624324 Nogo-B (Foocen, KIAA0886, My043, Nbla00271, Nbla10545, Neurite Outgrowth Inhibitor, Neuroendocrine-specific Protein, NI220/250, NSP, NSP-CL, Reticulon-4, Reticulon-5, RTN4-A, RTN4-B1, RTN4-B2, RTN4-C, RTN-x, RTN-X, SP1507, SP1507) Antibody 100ug 774 € MBS Polyclonals_1 human
NGR12-C Recombinant purified Human Nogo Receptor (Ngr)-Fc protein WB +ve control 100 μL 333 € adi human
NGR11-P Human Nogo Receptor (Ngr) Control/blocking peptide 100 μg 188 € adi human
MBS614670 Nogo 66 Receptor (Ngr) Antibody 0.05 ml 442 € MBS Polyclonals_1 human
MBS616830 Nogo 66 Receptor (Ngr) Antibody 50ug 492 € MBS Polyclonals_1 human
NGR11-A Rabbit Anti-Human Nogo Receptor (Ngr) 100 μg 565 € adi human
NGR11-S Rabbit Anti-Human Nogo Receptor (Ngr) antiserum 100 μL 536 € adi human
GENTAUR-58bdf0cd4358c Anti- RTN4R Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdf0cda8615 Anti- RTN4R Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be15c496151 Anti- RTN4R Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be15c503a60 Anti- RTN4R Antibody 0.12 ml 348 € MBS Polyclonals human
abx904742 Anti-RTN4R siRNA inquire 50 € abbex human
abx932260 Anti-RTN4R siRNA inquire 50 € abbex human
abx932261 Anti-RTN4R siRNA 15 nmol 528 € abbex human
LV294009 RTN4R Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
GWB-4CFBE3 RTN4R Over-expression Lysate reagent 1 x 1 vial 463 € genways human
MBS129785 RTN4R Polyclonal Antibody 200ug 558 € MBS Polyclonals_1 human
C531 Recombinant Human Nogo-66 Receptor-Related 3, NgR3, RTN4RL1 (C-6His) 500 µg 1613 € novo human
103-M267 Anti-Mouse Nogo receptor 100ug 336 € Reliatech antibodies mouse
GENTAUR-58bd59650763e Mouse Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 (Lingo1) 0.2 mg 591 € MBS Recombinant Proteins mouse