| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse CD74 is produced by our Mammalian expression system and the target gene encoding Gln56-Leu215 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
19, 4 kD |
| UniProt number: |
P04441-2 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKEPLDMEDLSSGLGVTRQELGQVTLVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
CD74 (C-6His), HLADG |
| Short name: |
CD74 (C-6His), Recombinant Mouse HLADG |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
CD74 molecule, class II invariant chain (C-6His), major histocompatibility complex, recombinant Mouse HLADG |
| Alternative technique: |
rec |
| Alternative to gene target: |
BT, CD74 and IDBG-53594 and ENSG00000019582 and 972, Cd74 and IDBG-150302 and ENSMUSG00000024610 and 16149, Cell surfaces, DHLAG and HLADG and Ia-GAMMA and II, MHC class II protein binding, class II invariant chain, major histocompatibility complex, signal transduction by p53 class mediator and biological process this GO :0044183 and protein binding involved in protein folding and molecular function this GO :0045058 and T cell selection and biological process this GO :0045059 and positive thymic T cell selection and biological process this GO :0045060 and negative thymic T cell selection and biological process this GO :0045581 and negative regulation of T cell differentiation and biological process this GO :0045582 and positive regulation of T cell differentiation and biological process this GO :0048146 and positive regulation of fibroblast proliferation and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0050998 and nitric-oxide synthase binding and molecular function this GO :0051085 and chaperone mediated protein folding requiring cofactor and biological process this GO :0060907 and positive regulation of macrophage cytokine production and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0071556 and integral component of lumenal side of endoplasmic reticulum membrane and cellular component this GO :0090023 and positive regulation of neutrophil chemotaxis and biological process this GO :1902166 and negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator and biological process this GO :2000343 and positive regulation of chemokine (C-X-C motif) ligand 2 production and biological process, this GO :0000139 and this GO lgi membrane and cellular component this GO :0000187 and activation of MAPK activity and biological process this GO :0001516 and prostaglandin biosynthetic process and biological process this GO :0001540 and beta-amyloid binding and molecular function this GO :0001961 and positive regulation of cytokine-mediated signaling pathway and biological process this GO :0002606 and positive regulation of dendritic cell antigen processing and presentation and biological process this GO :0002792 and negative regulation of peptide secretion and biological process this GO :0002830 and positive regulation of type 2 immune response and biological process this GO :0002906 and negative regulation of mature B cell apoptotic process and biological process this GO :0004896 and cytokine receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005764 and lysosome and cellular component this GO :0005765 and lysosomal membrane and cellular component this GO :0005770 and late endosome and cellular component this GO :0005771 and multivesicular body and cellular component this GO :0005773 and vacuole and cellular component this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006461 and protein complex assembly and biological process this GO :0006886 and intracellular protein transport and biological process this GO :0006952 and defense response and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0008283 and cell proliferation and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0012507 and ER to this GO lgi transport vesicle membrane and cellular component this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016064 and immunoglobulin mediated immune response and biological process this GO :0019882 and antigen processing and presentation and biological process this GO :0019883 and antigen processing and presentation of endogenous antigen and biological process this GO :0019886 and antigen processing and presentation of exogenous peptide antigen via MHC class II and biological process this GO :0019955 and cytokine binding and molecular function this GO :0023026 and MHC class II protein complex binding and molecular function this GO :0030658 and transport vesicle membrane and cellular component this GO :0030666 and endocytic vesicle membrane and cellular component this GO :0030669 and clathrin-coated endocytic vesicle membrane and cellular component this GO :0030890 and positive regulation of B cell proliferation and biological process this GO :0032588 and trans- this GO lgi network membrane and cellular component this GO :0035691 and macrophage migration inhibitory factor signaling pathway and biological process this GO :0035692 and macrophage migration inhibitory factor receptor complex and cellular component this GO :0035693 and NOS2-CD74 complex and cellular component this GO :0035718 and macrophage migration inhibitory factor binding and molecular function this GO :0042289 and MHC class II protein binding and molecular function this GO :0042613 and MHC class II protein complex and cellular component this GO :0042658 and MHC class II protein binding, this GO :0001540 : beta-amyloid binding, this GO :0001540 : beta-amyloid binding and also this GO :0004896 : cytokine receptor activity and also this GO :0005515 : protein binding and also this GO :0019955 : cytokine binding and also this GO :0023026 : MHC class II protein complex binding and also this GO :0035718 : macrophage migration inhibitory factor binding and also this GO :0042289 : MHC class II protein binding and also this GO :0042658 : MHC class II protein binding, this GO :0004896 : cytokine receptor activity, this GO :0005515 : protein binding, this GO :0019955 : cytokine binding, this GO :0023026 : MHC class II protein complex binding, this GO :0035718 : macrophage migration inhibitory factor binding, this GO :0042289 : MHC class II protein binding, this GO :0042658 : MHC class II protein binding, this GO :0042802 : identical protein binding, this GO :0044183 : protein binding involved in protein folding, this GO :0050998 : nitric-oxide synthase binding, via antigen binding groove, via antigen binding groove and also this GO :0042802 : identical protein binding and also this GO :0044183 : protein binding involved in protein folding and also this GO :0050998 : nitric-oxide synthase binding, via antigen binding groove and molecular function this GO :0042802 and identical protein binding and molecular function this GO :0043030 and regulation of macrophage activation and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043202 and lysosomal lumen and cellular component this GO :0043518 and negative regulation of DNA damage response, 46809 and IDBG-646288 and ENSBTAG00000015228 and 613384, CD74 molecule |
| Identity: |
1697 |
| Gene: |
CD74 |
More about : CD74 |
| Long gene name: |
CD74 molecule |
| Synonyms gene: |
DHLAG |
| Synonyms gene name: |
CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated) CD74 molecule, class II invariant chain , major histocompatibility complex |
| Synonyms name: |
HLA-DR-gamma Ia-associated invariant chain gamma chain of class II antigens MHC HLA-DR gamma chain |
| Locus: |
5q33, 1 |
| Discovery year: |
1986-01-01 |
| Entrez gene record: |
972 |
| Pubmed identfication: |
6324166 3001652 |
| RefSeq identity: |
NM_004355 |
| Classification: |
CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000163559 |