Recombinant Mouse HLADG, CD74 (C-6His)

Contact us
Catalog number: CM13
Price: 1109 €
Supplier: acr
Product name: Recombinant Mouse HLADG, CD74 (C-6His)
Quantity: 0,5 mg
Other quantities: 1 mg 1877€ 10 µg 126€ 500 µg 1328€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse CD74 is produced by our Mammalian expression system and the target gene encoding Gln56-Leu215 is expressed with a 6His tag at the C-terminus
Molecular Weight: 19, 4 kD
UniProt number: P04441-2
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKEPLDMEDLSSGLGVTRQELGQVTLVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CD74 (C-6His), HLADG
Short name: CD74 (C-6His), Recombinant Mouse HLADG
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: CD74 molecule, class II invariant chain (C-6His), major histocompatibility complex, recombinant Mouse HLADG
Alternative technique: rec
Alternative to gene target: BT, CD74 and IDBG-53594 and ENSG00000019582 and 972, Cd74 and IDBG-150302 and ENSMUSG00000024610 and 16149, Cell surfaces, DHLAG and HLADG and Ia-GAMMA and II, MHC class II protein binding, class II invariant chain, major histocompatibility complex, signal transduction by p53 class mediator and biological process this GO :0044183 and protein binding involved in protein folding and molecular function this GO :0045058 and T cell selection and biological process this GO :0045059 and positive thymic T cell selection and biological process this GO :0045060 and negative thymic T cell selection and biological process this GO :0045581 and negative regulation of T cell differentiation and biological process this GO :0045582 and positive regulation of T cell differentiation and biological process this GO :0048146 and positive regulation of fibroblast proliferation and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0050998 and nitric-oxide synthase binding and molecular function this GO :0051085 and chaperone mediated protein folding requiring cofactor and biological process this GO :0060907 and positive regulation of macrophage cytokine production and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0071556 and integral component of lumenal side of endoplasmic reticulum membrane and cellular component this GO :0090023 and positive regulation of neutrophil chemotaxis and biological process this GO :1902166 and negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator and biological process this GO :2000343 and positive regulation of chemokine (C-X-C motif) ligand 2 production and biological process, this GO :0000139 and this GO lgi membrane and cellular component this GO :0000187 and activation of MAPK activity and biological process this GO :0001516 and prostaglandin biosynthetic process and biological process this GO :0001540 and beta-amyloid binding and molecular function this GO :0001961 and positive regulation of cytokine-mediated signaling pathway and biological process this GO :0002606 and positive regulation of dendritic cell antigen processing and presentation and biological process this GO :0002792 and negative regulation of peptide secretion and biological process this GO :0002830 and positive regulation of type 2 immune response and biological process this GO :0002906 and negative regulation of mature B cell apoptotic process and biological process this GO :0004896 and cytokine receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005622 and intracellular and cellular component this GO :0005764 and lysosome and cellular component this GO :0005765 and lysosomal membrane and cellular component this GO :0005770 and late endosome and cellular component this GO :0005771 and multivesicular body and cellular component this GO :0005773 and vacuole and cellular component this GO :0005783 and endoplasmic reticulum and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006461 and protein complex assembly and biological process this GO :0006886 and intracellular protein transport and biological process this GO :0006952 and defense response and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0008283 and cell proliferation and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0012507 and ER to this GO lgi transport vesicle membrane and cellular component this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0016064 and immunoglobulin mediated immune response and biological process this GO :0019882 and antigen processing and presentation and biological process this GO :0019883 and antigen processing and presentation of endogenous antigen and biological process this GO :0019886 and antigen processing and presentation of exogenous peptide antigen via MHC class II and biological process this GO :0019955 and cytokine binding and molecular function this GO :0023026 and MHC class II protein complex binding and molecular function this GO :0030658 and transport vesicle membrane and cellular component this GO :0030666 and endocytic vesicle membrane and cellular component this GO :0030669 and clathrin-coated endocytic vesicle membrane and cellular component this GO :0030890 and positive regulation of B cell proliferation and biological process this GO :0032588 and trans- this GO lgi network membrane and cellular component this GO :0035691 and macrophage migration inhibitory factor signaling pathway and biological process this GO :0035692 and macrophage migration inhibitory factor receptor complex and cellular component this GO :0035693 and NOS2-CD74 complex and cellular component this GO :0035718 and macrophage migration inhibitory factor binding and molecular function this GO :0042289 and MHC class II protein binding and molecular function this GO :0042613 and MHC class II protein complex and cellular component this GO :0042658 and MHC class II protein binding, this GO :0001540 : beta-amyloid binding, this GO :0001540 : beta-amyloid binding and also this GO :0004896 : cytokine receptor activity and also this GO :0005515 : protein binding and also this GO :0019955 : cytokine binding and also this GO :0023026 : MHC class II protein complex binding and also this GO :0035718 : macrophage migration inhibitory factor binding and also this GO :0042289 : MHC class II protein binding and also this GO :0042658 : MHC class II protein binding, this GO :0004896 : cytokine receptor activity, this GO :0005515 : protein binding, this GO :0019955 : cytokine binding, this GO :0023026 : MHC class II protein complex binding, this GO :0035718 : macrophage migration inhibitory factor binding, this GO :0042289 : MHC class II protein binding, this GO :0042658 : MHC class II protein binding, this GO :0042802 : identical protein binding, this GO :0044183 : protein binding involved in protein folding, this GO :0050998 : nitric-oxide synthase binding, via antigen binding groove, via antigen binding groove and also this GO :0042802 : identical protein binding and also this GO :0044183 : protein binding involved in protein folding and also this GO :0050998 : nitric-oxide synthase binding, via antigen binding groove and molecular function this GO :0042802 and identical protein binding and molecular function this GO :0043030 and regulation of macrophage activation and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043202 and lysosomal lumen and cellular component this GO :0043518 and negative regulation of DNA damage response, 46809 and IDBG-646288 and ENSBTAG00000015228 and 613384, CD74 molecule
Identity: 1697
Gene: CD74 | More about : CD74
Long gene name: CD74 molecule
Synonyms gene: DHLAG
Synonyms gene name: CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated) CD74 molecule, class II invariant chain , major histocompatibility complex
Synonyms name: HLA-DR-gamma Ia-associated invariant chain gamma chain of class II antigens MHC HLA-DR gamma chain
Locus: 5q33, 1
Discovery year: 1986-01-01
Entrez gene record: 972
Pubmed identfication: 6324166 3001652
RefSeq identity: NM_004355
Classification: CD molecules
Havana BLAST/BLAT: OTTHUMG00000163559

Related Products :

CM13 Recombinant Mouse HLADG, CD74 (C-6His) 10 µg 126 € novo mouse
CJ51 Recombinant Mouse HLADG, CD74 (C-mFc-6His) 50 µg 303 € novo mouse
GWB-82D738 CD74 Antigen (invariant Poly peptide sequence Of Major Histocompatibility Complex Class II Antigen-associated) (CD74) Mouse antibody to or anti-Human Mo 1 volume 602 € genways human
abx261072 Anti-CD74 Protein (Recombinant) 20 µg 340 € abbex human
GWB-ATG232 CD74, 73-232aa, Human, His tag, E.coli, Recombinant Protein bulk Ask price € genways bulk human
RP-0362H Recombinant Human CD74 Protein (His Tag) 50μg 624 € adv human
YSGCSA170C CD74, ~33-35kD doublet, Clone: PIN.1, Mouse Monoclonal antibody-Human; WB/IP/ICC/FACS 25 ug 540 € accurate-monoclonals human
YSGCSA170E CD74, ~33-35kD doublet, Clone: PIN.1, Mouse Monoclonal antibody-Human; WB/IP/ICC/FACS 0.1mg 1150 € accurate-monoclonals human
AXL3639M CD74, B-Cell, Clone: LN2, Mouse Monoclonal antibody-Human 1000ul Ask price € accurate-monoclonals human
YSRTMCA688 CD74, B-Cell, Monocyte, Macrophage, MHC Class II Assoc, gp41/35/33, Clone: BU45, Mouse Monoclonal antibody-Hu; frozen/paraffin, IH/flow/IP 250ul Ask price € accurate-monoclonals mouse
CLBM2163 CD74, B-Cell, Monocyte, Macrophage, MHC Class II Associated, Clone: BU45, Mouse Monoclonal antibody-Hu; frozen/paraffin 1000ul 809 € accurate-monoclonals mouse
YSRTMCA2364A488 CD74, Clone: AT14/19, Mouse Monoclonal antibody-, ALEXA 488 conj. vial Ask price € accurate-monoclonals mouse
YSGCSA175F CD74, Clone: LN-2, Mouse Monoclonal antibody-Human; IHC 200 ul 899 € accurate-monoclonals human
BMDV6049 CD74, MHC Class II Invarient Chain, Clone: B318 (LN-2), Mouse Monoclonal antibody-Human 200ug 749 € accurate-monoclonals human
BMDF649 CD74, MHC Class II Invarient Chain, Clone: B318 (LN-2), Mouse Monoclonal antibody-Human, FITC 0.1 mg 489 € accurate-monoclonals human
BYA9134-1 CD74, MHC Class II Invarient Chain (Ii), Clone: LN-2, Mouse Monoclonal antibody-Hu; frozen/paraffin (microwave pretreat) 0.2 ml 385 € accurate-monoclonals mouse
YM1170 HLA-D associated (MHC Class II), CD74, B-Cell, Monocyte, Macrophage, Clone: BU45, Mouse Monoclonal antibody-Hu, frozen/paraffin 250ul Ask price € accurate-monoclonals mouse
MEDCLA210 HLA-DR (MHC Class II) Invarient Chain, CD74, Lymphoid Marker, p35, Clone: LN-2, Mouse Monoclonal antibody-Human; frozen/paraffin 1000ul 1051 € accurate-monoclonals human
GENTAUR-58bde00f54625 MOUSE Anti-HUMAN CD74 Antibody 200ug 503 € MBS mono human
GENTAUR-58bde02f8d2c4 MOUSE Anti-HUMAN CD74 Antibody 200ug 503 € MBS mono human
GENTAUR-58bde3448e13b MOUSE Anti-HUMAN CD74 Antibody 0.025 miligrams 221 € MBS mono human
GENTAUR-58bde36a1761f MOUSE Anti-HUMAN CD74 Antibody 0.025 miligrams 205 € MBS mono human
GWB-AF8349 Mouse antibody to or anti-Human CD74, antibody 1 vial 447 € genways human
GWB-DAE407 Mouse antibody to or anti-Human CD74, antibody 1 vial 735 € genways human
GWB-F2CF9C Mouse antibody to or anti-Human CD74, antibody 1 vial 319 € genways human
GWB-F56BC6 Mouse antibody to or anti-Human CD74, antibody 1 vial 447 € genways human
GENTAUR-58bde5b276043 Mouse Monoclonal [clone LN2] (IgG1) to Human CD74 Antibody 50ug 597 € MBS mono human
GENTAUR-58bde5c181a74 Mouse Monoclonal [clone LN2] (IgG1,k) to Human CD74 Antibody 50ug 597 € MBS mono human
GENTAUR-58bde7a1716bd Mouse Monoclonal [clone PIN.1] (IgG) to Human CD74 Antibody 50ug 597 € MBS mono human
AR50928PU-N anti-CD74 (73-232, His-tag) Antibody 0,5 mg 1109 € acr human