Recombinant Mouse Tissue Inhibitors of Metalloproteinases 1, TIMP1

Contact us
Catalog number: CM11
Price: 402 €
Supplier: abebio
Product name: Recombinant Mouse Tissue Inhibitors of Metalloproteinases 1, TIMP1
Quantity: 1x plate of 48 wells
Other quantities: 1 mg 2486€ 10 µg 202€ 500 µg 1755€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Tissue Inhibitors of Metalloproteinases 1 is produced by our Mammalian expression system and the target gene encoding Cys25-Arg205 is expressed
Molecular Weight: 2 kD, 20
UniProt number: P12032
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0, pH8
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: CSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: TIMP1, Tissue Inhibitors of Metalloproteinases 1
Short name: TIMP1, Recombinant Mouse Tissue Inhibitors of Metalloproteinases 1
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: TIMP1, recombinant Mouse Tissue Inhibitors on Metalloproteinases 1
Alternative technique: rec
Identity: 11820
Gene: TIMP1 | More about : TIMP1
Long gene name: TIMP metallopeptidase inhibitor 1
Synonyms gene: TIMP CLGI
Synonyms gene name: collagenase inhibitor) , tissue inhibitor of metalloproteinase 1 (erythroid potentiating activity
Synonyms: EPO
Locus: Xp11, 3
Discovery year: 1986-01-01
Entrez gene record: 7076
RefSeq identity: NM_003254
Classification: Tissue inhibitor of metallopeptidases
Havana BLAST/BLAT: OTTHUMG00000021447
Locus Specific Databases: Mental Retardation database

Related Products :

CM11 Recombinant Mouse Tissue Inhibitors of Metalloproteinases 1, TIMP1 1 mg 2486 € novo mouse
CC68 Recombinant Mouse Tissue Inhibitor of Metalloproteinases 2, TIMP-2 (C-6His) 500 µg 1613 € novo mouse
C456 Recombinant Human Tissue Inhibitor of Metalloproteinases 1, TIMP-1 (C-6His) 1 mg 2283 € novo human
C459 Recombinant Human Tissue Inhibitor of Metalloproteinases 2, TIMP-2 (C-6His) 500 µg 1613 € novo human
CJ60 Recombinant Human Tissue Inhibitor of Metalloproteinases 4, TIMP-4 (C-6His) 500 µg 1613 € novo human
DL-TIMP1-Mu Mouse Tissue Inhibitors Of Metalloproteinase 1 TIMP1 ELISA Kit 96T 730 € DL elisas mouse
GENTAUR-58bdc5878f180 Anti- Tissue Inhibitors Of Metalloproteinase 1 (TIMP1) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdc5d9b8904 Anti- Tissue Inhibitors Of Metalloproteinase 1 (TIMP1) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdc90576726 Anti- Tissue Inhibitors Of Metalloproteinase 1 (TIMP1) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdc905d6715 Anti- Tissue Inhibitors Of Metalloproteinase 1 (TIMP1) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc9352606c Anti- Tissue Inhibitors Of Metalloproteinase 1 (TIMP1) Antibody 100ug 365 € MBS Polyclonals human
GENTAUR-58bdc93590f24 Anti- Tissue Inhibitors Of Metalloproteinase 1 (TIMP1) Antibody 50ug 299 € MBS Polyclonals human
GENTAUR-58bdca19090ae Anti- Tissue Inhibitors Of Metalloproteinase 1 (TIMP1) Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58bdcc07ce490 Anti- Tissue Inhibitors Of Metalloproteinase 1 (TIMP1) Antibody 50ug 293 € MBS Polyclonals human
GENTAUR-58bdcc0834c9b Anti- Tissue Inhibitors Of Metalloproteinase 1 (TIMP1) Antibody 100ug 359 € MBS Polyclonals human
GENTAUR-58bdcc6c4e0df Anti- Tissue Inhibitors Of Metalloproteinase 1 (TIMP1) Antibody 100ug 376 € MBS Polyclonals human
GENTAUR-58bdcf3f9ef88 Anti- Tissue Inhibitors Of Metalloproteinase 1 (TIMP1) Antibody 100ug 376 € MBS Polyclonals human
GENTAUR-58bdcff9c41ab Anti- Tissue Inhibitors Of Metalloproteinase 1 (TIMP1) Antibody 50ug 293 € MBS Polyclonals human
GENTAUR-58bdcffa2390b Anti- Tissue Inhibitors Of Metalloproteinase 1 (TIMP1) Antibody 100ug 359 € MBS Polyclonals human
GENTAUR-58bdd067bbe64 Anti- Tissue Inhibitors Of Metalloproteinase 1 (TIMP1) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdd0683f272 Anti- Tissue Inhibitors Of Metalloproteinase 1 (TIMP1) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdd474edbee Anti- Tissue Inhibitors Of Metalloproteinase 1 (TIMP1) Antibody 100ug 398 € MBS Polyclonals human
GENTAUR-58bdd54f602e4 Anti- Tissue Inhibitors Of Metalloproteinase 1 (TIMP1) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bddb202b372 Anti- Tissue Inhibitors Of Metalloproteinase 1 (TIMP1) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bddcbf7b03a Anti- Tissue Inhibitors Of Metalloproteinase 1 (TIMP1) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bddd07c0d12 Anti- Tissue Inhibitors Of Metalloproteinase 1 (TIMP1) Antibody 100ug 575 € MBS Polyclonals human
DL-TIMP1-b Bovine Tissue Inhibitors Of Metalloproteinase 1 TIMP1 ELISA Kit 96T 962 € DL elisas bovine
DL-TIMP1-c Canine Tissue Inhibitors Of Metalloproteinase 1 TIMP1 ELISA Kit 96T 921 € DL elisas human
KT-32318 Dog Tissue Inhibitors of Metalloproteinase 1 (TIMP1) ELISA kit 96 well plate 1233 € Kamiya dog
AE14958SH-48 ELISA test for Sheep Tissue inhibitors of metalloproteinase 1 (TIMP1) 1x plate of 48 wells 402 € abebio sheep