| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Not all receptor antagonist that bind to enzymes are inhibitors, Since blocking an enzyme's activity can kill a pathogen , activator, caspase, esterase inhibitors , lipoprotein, many drugs are enzyme inhibitors, papain, pathway, peptidase, protease , proteinase, trypsin, while enzyme substrates bind and are converted to products in the normal catalytic cycle of the enzyme,  , Tissue, acrosin, activity, and decreases its , are , bind to enzymes and increase their , enzymatic activity, enzyme activator ligands or agonists , enzyme receptor , imbalance, metabolic , or correct a , or receptor ligands or receptor antagonists that bind to an , proteins  |
| Molecular Weight: |
22, 79 kD |
| UniProt number: |
P16035 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDPVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
TIMP-2 (C-6His), Tissue Inhibitor of Metalloproteinases 2 |
| Short name: |
TIMP-2 (C-6His), Recombinant Tissue Inhibitor of Metalloproteinases 2 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
TIMP-2 (C-6His), sapiens Tissue suppressor on Metalloproteinases 2, recombinant H |
| Alternative technique: |
rec |