| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Receptor agonists are often tested for drug development, FAS ligand and other ligands are binding to the receptor for signaling pathways for example in apoptosis or JNK signaling |
| Molecular Weight: |
45, 5 kD |
| UniProt number: |
P49772 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
FLT3LG (C-Fc), Fms-Like Tyrosine Kinase 3 Ligand |
| Short name: |
FLT3LG (C-Fc), Recombinant Mouse Fms-Like Tyrosine Kinase 3 Ligand |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
fms-related tyrosine phosphorylation catalyst 3 ligand (C-fragment c), recombinant Mouse Fms-Like Tyrosine phosphorylation catalyst 3 Ligand |
| Alternative technique: |
rec |
| Alternative to gene target: |
Extracellular, FL and FLT3L, FLT3LG and IDBG-62803 and ENSG00000090554 and 2323, FLT3LG and IDBG-640541 and ENSBTAG00000038045 and 282233, Flt3l and IDBG-488510 and ENSMUSG00000089989 and 14256, protein homodimerization activity, this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0005102 and receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005615 and extracellular space and cellular component this GO :0007165 and signal transduction and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0009986 and cell surface and cellular component this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0030098 and lymphocyte differentiation and biological process this GO :0030971 and receptor tyrosine kinase binding and molecular function this GO :0031233 and intrinsic to external side of plasma membrane and cellular component this GO :0032825 and positive regulation of natural killer cell differentiation and biological process this GO :0035162 and embryonic hemopoiesis and biological process this GO :0042803 and protein homodimerization activity and molecular function, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005125 : cytokine activity and also this GO :0030971 : receptor tyrosine kinase binding and also this GO :0042803 : protein homodimerization activity, this GO :0005125 : cytokine activity, this GO :0030971 : receptor tyrosine kinase binding, this GO :0042803 : protein homodimerization activity, fms-related tyrosine kinase 3 ligand |
| Identity: |
3766 |
| Gene: |
FLT3LG |
More about : FLT3LG |
| Long gene name: |
fms related tyrosine kinase 3 ligand |
| Synonyms gene name: |
fms-related tyrosine kinase 3 ligand |
| Locus: |
19q13, 33 |
| Discovery year: |
1994-07-21 |
| GenBank acession: |
U04806 |
| Entrez gene record: |
2323 |
| Pubmed identfication: |
8145851 7824267 |
| Classification: |
Endogenous ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000186490 |