Recombinant Mouse Kallikrein 7, KLK7 (C-6His)

Contact us
Catalog number: CK86
Price: 2283 €
Supplier: novo
Product name: Recombinant Mouse Kallikrein 7, KLK7 (C-6His)
Quantity: 1 mg
Other quantities: 1 mg 2486€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Kallikrein 7 is produced by our Mammalian expression system and the target gene encoding Gln22-Arg249 is expressed with a 6His tag at the C-terminus
Molecular Weight: 1 kD, 26
UniProt number: Q91VE3
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM HEPES, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QGERIIDGYKCKEGSHPWQVALLKGNQLHCGGVLVDKYWVLTAAHCKMGQYQVQLGSDKIGDQSAQKIKATKSFRHPGYSTKTHVNDIMLVRLDEPVKMSSKVEAVQLPEHCEPPGTSCTVSGWGTTTSPDVTFPSDLMCSDVKLISSRECKKVYKDLLGKTMLCAGIPDSKTNTCNGDSGGPLVCNDTLQGLVSWGTYPCGQPNDPGVYTQVCKYKRWVMETMKTHRVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: KLK7 (C-6His), Kallikrein 7
Short name: KLK7 (C-6His), Recombinant Mouse Kallikrein 7
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: KLK7 (C-6His), recombinant Mouse Kallikrein 7
Alternative technique: rec
Identity: 6368
Gene: KLK7 | More about : KLK7
Long gene name: kallikrein related peptidase 7
Synonyms gene: PRSS6
Synonyms gene name: kallikrein 7 (chymotryptic, stratum corneum)
Synonyms: SCCE
Locus: 19q13, 33
Discovery year: 1995-06-14
GenBank acession: L33404
Entrez gene record: 5650
Pubmed identfication: 8034709 16800724 16800723
RefSeq identity: NM_005046
Classification: Kallikreins Proteases, serine
Havana BLAST/BLAT: OTTHUMG00000182917

Related Products :

CK86 Recombinant Mouse Kallikrein 7, KLK7 (C-6His) 50 µg 496 € novo mouse
C364 Recombinant Human Kallikrein 7, KLK7, SCEE (C-6His 1 mg 2283 € novo human
RP-1381M Recombinant Mouse KLK7 / Kallikrein 7 Protein (His Tag) 10μg 624 € adv mouse
MBS619101 KLK1B27 (Klk1b27, kallikrein 1-related peptidase b27, Gk27, Klk27, mGK-27, glandular kallikrein 27, kallikrein 27) Antibody 100ug 509 € MBS Polyclonals_1 human
abx571173 Anti-Mouse Kallikrein 7 (KLK7) ELISA Kit inquire 50 € abbex mouse
DL-KLK7-Mu Mouse Kallikrein 7 KLK7 ELISA Kit 96T 904 € DL elisas mouse
abx570405 Anti-Human Kallikrein 7 (KLK7) ELISA Kit 96 tests 673 € abbex human
GENTAUR-58bdc2c83ccd6 Anti- Kallikrein 7 (KLK7) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdc2c88e23d Anti- Kallikrein 7 (KLK7) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc4921e926 Anti- Kallikrein 7 (KLK7) Antibody 50ug 332 € MBS Polyclonals human
GENTAUR-58bdc49297c01 Anti- Kallikrein 7 (KLK7) Antibody 100ug 409 € MBS Polyclonals human
GENTAUR-58bdc4997b1c7 Anti- Kallikrein 7 (KLK7) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc499def82 Anti- Kallikrein 7 (KLK7) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdc83b97322 Anti- Kallikrein 7 (KLK7) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdc906b8aa5 Anti- Kallikrein 7 (KLK7) Antibody 100ug 442 € MBS Polyclonals human
GENTAUR-58bdcde6726d3 Anti- Kallikrein 7 (KLK7) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd4f8588be Anti- Kallikrein 7 (KLK7) Antibody 100ug 475 € MBS Polyclonals human
GENTAUR-58bdd7ca8a4dd Anti- Kallikrein 7 (KLK7) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bddcc84771b Anti- Kallikrein 7 (KLK7) Antibody 100ug 580 € MBS Polyclonals human
AR50561PU-N anti-KLK7 / Kallikrein-7 (30-253, His-tag) Antibody 0,5 mg 1109 € acr human
AR50561PU-S anti-KLK7 / Kallikrein-7 (30-253, His-tag) Antibody 0,1 mg 485 € acr human
DL-KLK7-Hu Human Kallikrein 7 KLK7 ELISA Kit 96T 788 € DL elisas human
EKU05449 Kallikrein 7 (KLK7) ELISA kit 1 plate of 96 wells 667 € Biomatik ELISA kits human
EKU05450 Kallikrein 7 (KLK7) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
C481 Recombinant Human Kallikrein 1, KLK1 (C-6His) 10 µg 202 € novo human
C360 Recombinant Human Kallikrein 10, KLK10 (C-6His) 50 µg 496 € novo human
C361 Recombinant Human Kallikrein 11, KLK11 (C-6His) 1 mg 2283 € novo human
C362 Recombinant Human Kallikrein 13, KLK13 (C-6His) 50 µg 496 € novo human
C616 Recombinant Human Kallikrein 2, KLK2 (C-6His) 50 µg 496 € novo human
C363 Recombinant Human Kallikrein 4, KLK4 (C-6His) 1 mg 2283 € novo human