| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Kallikrein 2 is produced by our Mammalian expression system and the target gene encoding Pro19-Pro261 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
27, 9 kD |
| UniProt number: |
P20151 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
150 mM sodium chloride, pH 3, 2 um filtered solution of 20 mM Citrate, 5, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
PLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANPVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
KLK2 (C-6His), Kallikrein 2 |
| Short name: |
KLK2 (C-6His), Recombinant Kallikrein 2 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
KLK2 (C-6His), sapiens Kallikrein 2, recombinant H |
| Alternative technique: |
rec |
| Identity: |
6363 |
| Gene: |
KLK2 |
More about : KLK2 |
| Long gene name: |
kallikrein related peptidase 2 |
| Synonyms gene name: |
kallikrein 2, prostatic |
| Locus: |
19q13, 33 |
| Discovery year: |
1988-08-11 |
| GenBank acession: |
M18157 |
| Entrez gene record: |
3817 |
| Pubmed identfication: |
2468530 16800724 16800723 |
| RefSeq identity: |
NM_005551, 3 |
| Classification: |
Kallikreins |
| Havana BLAST/BLAT: |
OTTHUMG00000182963 |