| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
HRAS like - suppressor protein make genetic suppression restoring the phenotype seen prior to the original background in , breast cancer tumor, Kinase, biological pathways |
| Molecular Weight: |
18, 4 kD |
| UniProt number: |
Q61477 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
APPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKIVHCSCQACGKEPSHEGLNVYVQGEDSPGSQPGPHSHAHPHPGGQTPEPEEPPGAPQVEEEGAEDVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
NBL1 (C-6His), Neuroblastoma Suppressor of Tumorigenicity 1 |
| Short name: |
NBL1 (C-6His), Recombinant Mouse Neuroblastoma Suppressor of Tumorigenicity 1 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
NBL1 (C-6His), recombinant Mouse Neuroblastoma Suppressor on Tumorigenicity 1 |
| Alternative technique: |
rec |
| Identity: |
7650 |
| Gene: |
NBL1 |
More about : NBL1 |
| Long gene name: |
DAN family BMP antagonist , neuroblastoma 1 |
| Synonyms gene name: |
neuroblastoma, suppression of tumorigenicity 1 |
| Synonyms: |
D1S1733E NB DAN NO3 DAND1 |
| Synonyms name: |
neuroblastoma candidate region, suppression of tumorigenicity 1 neuroblastoma suppressor of tumorigenicity 1 differential screening-selected gene aberrant in neuroblastoma |
| Locus: |
1p36, 13 |
| Discovery year: |
1997-11-20 |
| Entrez gene record: |
4681 |
| Pubmed identfication: |
7633401 |
| RefSeq identity: |
NM_005380 |
| Classification: |
DAN family |
| Havana BLAST/BLAT: |
OTTHUMG00000002700 |