Recombinant Mouse T cell Immunoglobulin and Mucin Domain-3, TIM-3, HAVCR2 (C-6His)

Contact us
Catalog number: CK57
Price: 785 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Mouse T cell Immunoglobulin and Mucin Domain-3, TIM-3, HAVCR2 (C-6His)
Quantity: 100ul
Other quantities: 1 mg 1674€ 10 µg 110€ 50 µg 232€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: cell lines and tissues in culture till half confluency, For cells
Molecular Weight: 19, 9 kD
UniProt number: Q8VIM0
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: LENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIRTAHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: HAVCR2 (C-6His), TIM-3, T Immunoglobulin Mucin Domain-3
Short name: HAVCR2 (C-6His), TIM-3, Recombinant Mouse T Immunoglobulin Mucin Domain-3
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: TIM-3, hepatitis A virus cellular receptor 2 (C-6His), recombinant Mouse T cellular Immunoglobulin and Mucin Domain-3
Alternative technique: rec
Alternative to gene target: HAVCR2 and IDBG-55271 and ENSG00000135077 and 84868, Havcr2 and IDBG-165782 and ENSMUSG00000020399 and 171285, Plasma membranes, protein binding, this GO :0005515 and protein binding and molecular function this GO :0016021 and integral component of membrane and cellular component this GO :0045087 and innate immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding, hepatitis A virus cellular receptor 2
Identity: 18437
Gene: HAVCR2 | More about : HAVCR2
Long gene name: hepatitis A virus cellular receptor 2
Synonyms: Tim-3 TIM3 FLJ14428 TIMD3 CD366
Synonyms name: T-cell immunoglobulin mucin family member 3
Locus: 5q33, 3
Discovery year: 2002-12-04
GenBank acession: AK027334
Entrez gene record: 84868
Pubmed identfication: 11823861
Classification: V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000130249

Related Products :

CK57 Recombinant Mouse T cell Immunoglobulin and Mucin Domain-3, TIM-3, HAVCR2 (C-6His) 1 mg 1674 € novo mouse
CM54 Recombinant Mouse T Cell Immunoglobulin and Mucin Domain-3, TIM-3, HAVCR2 (C-6His) 1 mg 1877 € novo mouse
CD71 Recombinant Human T Cell Immunoglobulin and Mucin Domain-3, TIM-3, HAVCR2 (C-Fc-6His) 1 mg 2283 € novo human
CM03 Recombinant Mouse T Cell Immunoglobulin and Mucin Domain-3, TIM-3, HAVCR2 (C-Fc) 1 mg 1877 € novo mouse
MBS620755 Tim3 (T Cell Immunoglobulin and Mucin Domain-containing 3, T Cell Immunoglobulin Mucin 3, TIM3, TIM-3, TIMD3, FLJ14428, Hepatitis A Virus Cellular Receptor 2, HAVCR 2, HAVCR2, HAVCR-2, Kidney Injury Molecule 3, KIM-3) 100ug 741 € MBS Polyclonals_1 virus
C356 Recombinant Human T Cell Immunoglobulin and Mucin Domain-3, TIM3, HAVCR2 (C-6His) 50 µg 263 € novo human
CM64 Recombinant Marmoset T Cell Ig and Mucin Domain-3, TIM3, HAVCR2 (C-6His) 1 mg 1877 € novo human
103-M274 Anti-Mouse T-cell Immunoglobulin Mucin-1 (TIM-1) 100ug 336 € Reliatech antibodies mouse
103-M275 Anti-Mouse T-cell Immunoglobulin Mucin-2 (TIM-2) 100ug 336 € Reliatech antibodies mouse
103-M276 Anti-Mouse T-cell Immunoglobulin Mucin-3 (TIM-3) 100ug 336 € Reliatech antibodies mouse
CS54 Recombinant Cynomolgus TIM-3, HAVCR2 (C-Fc) 1 mg 2283 € novo human
CU05 Recombinant Human TIM-3, HAVCR2 (C-Fc-Avi) 10 µg 126 € novo human
RP-1508H Recombinant Human TIM-3 / HAVCR2 Protein (His & Fc Tag) 50μg 624 € adv human
RP-1507H Recombinant Human TIM-3 / HAVCR2 Protein (His Tag) 50μg 659 € adv human
MBS620254 Tim4, CT (T Cell Immunoglobulin and Mucin Domain Containing Protein 4, FLJ27515, T-cell Membrane Protein 4, TIM4, TIMD-4, TIMD4) Antibody 100ug 774 € MBS Polyclonals_1 human
MBS244729 Anti-Human HAVCR2 / TIM-3 Antibody 0.05 ml 597 € MBS Polyclonals_1 human
GENTAUR-58bcb95644e19 Neurospora crassa Mitochondrial import inner membrane translocase subunit tim-17 (tim-17) 1000ug 1453 € MBS Recombinant Proteins human
GENTAUR-58bcb95692ba9 Neurospora crassa Mitochondrial import inner membrane translocase subunit tim-17 (tim-17) 1000ug 1962 € MBS Recombinant Proteins human
MBS621421 Semaphorin 4B (SEMA4B, Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain) (Biotin) 50ug 818 € MBS Polyclonals_1 human
GENTAUR-58bd703ce2638 Human T-cell immunoglobulin and mucin domain-containing protein 4 (TIMD4) 100ug 1846 € MBS Recombinant Proteins human
GENTAUR-58bd703d4ba36 Human T-cell immunoglobulin and mucin domain-containing protein 4 (TIMD4) 1000ug 1846 € MBS Recombinant Proteins human
GENTAUR-58bd703d80dca Human T-cell immunoglobulin and mucin domain-containing protein 4 (TIMD4) 100ug 2359 € MBS Recombinant Proteins human
GENTAUR-58bd703dcd6f3 Human T-cell immunoglobulin and mucin domain-containing protein 4 (TIMD4) 1000ug 2359 € MBS Recombinant Proteins human
DL-TIMD4-Hu Human T-Cell Immunoglobulin And Mucin Domain Containing Protein 4 TIMD4 ELISA Kit 96T 904 € DL elisas human
GWB-9766B7 T-cell Immunoglobulin And Mucin Domain Containing 4 (TIMD4) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody 1 vial 602 € genways human
GWB-FBDAFA T-cell Immunoglobulin And Mucin Domain Containing 4 (TIMD4) Rabbit antibody to or anti-Human Polyclonal (Internal) antibody 1 vial 602 € genways human
EKU07581 T-Cell Immunoglobulin And Mucin Domain Containing Protein 4 (TIMD4) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
MBS611541 Tim4 (T Cell Immunoglobulin and Mucin Domain Containing Protein 4, FLJ27515, TIMD-4, TIMD4) Antibody 50ug 724 € MBS Polyclonals_1 human
C260 Recombinant Human Triosephosphate Isomerase, TIM (N-6His) 50 µg 496 € novo human
MBS619444 FBXW7 (F-box and WD 40 Domain Protein 7, F-box and WD-40 Domain Protein 7, F-box and WD-40 Domain-containing Protein 7, F-box Protein FBW7, F-box/WD Repeat Protein 7, F-box/WD-repeat Protein 7, FBW7, Archipelago Drosophila Homolog of, Archipelago Homolog, Antibody 100ul 785 € MBS Polyclonals_1 drosophila