| Reacts with: |
Marmoset |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Marmoset TIM-3 is produced by our Mammalian expression system and the target gene encoding Glu24-Ile193 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
19, 7 kD |
| UniProt number: |
F7I881 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
EEYIVEVGQNAYLPCFYTLDTPGNLVPVCWGKGACPVFECGDVVLRTDERDVSYRTSSRYWLNGDFHKGNVTLAIGNVTLEDSGIYCCRVQIPGIMNDKKFNLKLVIKPAKVTPAPTLPRDSTPAFPRMLTTEDHGPAETQTLEILHDKNLTQLSTLANELQDAGTTIRIHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Group: |
recombinants |
| Gene target: |
HAVCR2 (C-6His), TIM3, Marmoset T Ig Mucin Domain-3 |
| Short name: |
HAVCR2 (C-6His), TIM3, Recombinant Marmoset T Cell Ig Mucin Domain-3 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Alternative name: |
TIM3, hepatitis A virus cellular receptor 2 (C-6His), recombinant Marmoset T cellular Ig and Mucin Domain-3 |
| Alternative technique: |
rec |
| Alternative to gene target: |
HAVCR2 and IDBG-55271 and ENSG00000135077 and 84868, Havcr2 and IDBG-165782 and ENSMUSG00000020399 and 171285, Plasma membranes, protein binding, this GO :0005515 and protein binding and molecular function this GO :0016021 and integral component of membrane and cellular component this GO :0045087 and innate immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding, hepatitis A virus cellular receptor 2 |
| Identity: |
18437 |
| Gene: |
HAVCR2 |
More about : HAVCR2 |
| Long gene name: |
hepatitis A virus cellular receptor 2 |
| Synonyms: |
Tim-3 TIM3 FLJ14428 TIMD3 CD366 |
| Synonyms name: |
T-cell immunoglobulin mucin family member 3 |
| Locus: |
5q33, 3 |
| Discovery year: |
2002-12-04 |
| GenBank acession: |
AK027334 |
| Entrez gene record: |
84868 |
| Pubmed identfication: |
11823861 |
| Classification: |
V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000130249 |