| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Carbonic anhydrase 14 is produced by our E, coli expression system and the target gene encoding Ala16-Met290 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
3 kD, 32 |
| UniProt number: |
Q9WVT6 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Supplied as a 0, pH8 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MNHKVHHHHHHMADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEM |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
CA14 (N-6His), Carbonic Ahydrase 14 |
| Short name: |
CA14 (N-6His), Recombinant Mouse Carbonic Ahydrase 14 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
CA14 (N-6His), recombinant Mouse Carbonic Ahydrase 14 |
| Alternative technique: |
rec |
| Identity: |
1372 |
| Gene: |
CA14 |
More about : CA14 |
| Long gene name: |
carbonic anhydrase 14 |
| Synonyms gene name: |
carbonic anhydrase XIV |
| Locus: |
1q21, 2 |
| Discovery year: |
1999-11-16 |
| GenBank acession: |
AB025904 |
| Entrez gene record: |
23632 |
| Pubmed identfication: |
10512682 |
| RefSeq identity: |
NM_012113 |
| Classification: |
Carbonic anhydrases |
| Havana BLAST/BLAT: |
OTTHUMG00000012549 |