Recombinant Mouse IL-1 Receptor Antagonist Protein, IL-1ra, IL-1RA

Contact us
Catalog number: CK20
Price: 220 €
Supplier: Immunochemistry kits
Product name: Recombinant Mouse IL-1 Receptor Antagonist Protein, IL-1ra, IL-1RA
Quantity: 5 µg
Other quantities: 1 mg 2486€ 50 µg 496€ 500 µg 1755€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Interleukin-1 Receptor Antagonist Protein is produced by our E, coli expression system and the target gene encoding Arg27-Gln178 is expressed
Molecular Weight: 17, 5 kD
UniProt number: P25085
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MRPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Gene: E, Rec, coli interleukin-1 for cell culture or antibody production, which plays a central role in the regulation of immune and inflammatory responses to infections or sterile insults, Interleukin-1 family (IL-1 family) , The , cytokines, is a group of 11  | More about : E, Rec, coli interleukin-1 for cell culture or antibody production, which plays a central role in the regulation of immune and inflammatory responses to infections or sterile insults, Interleukin-1 family (IL-1 family) , The , cytokines, is a group of 11 
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: IL-1RA, IL-1ra, IL-1 Receptor Antagonist Protein
Short name: IL-1RA, IL-1ra, Recombinant Mouse IL-1 Receptor Antagonist Protein
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: Interleukin-1RA, Interleukin-1ra, recombinant Mouse Interleukin-1 Receptor Antagonist Protein
Alternative technique: rec

Related Products :

CK20 Recombinant Mouse IL-1 Receptor Antagonist Protein, IL-1ra, IL-1RA 500 µg 1755 € novo mouse
C033 Recombinant Human IL-1 Receptor Antagonist Protein, IL-1RA, IL-1F3 500 µg 674 € novo human
AE38368MO-48 ELISA test for Mouse Interleukin 1 receptor antagonist (IL-1ra) 1x plate of 48 wells 402 € abebio mouse
YSRTMCA1467 Interleukin 1 Receptor Antagonist (IL-1RA), Clone: 1384, Mouse Monoclonal antibody-Human; frozen, IH/ELISA (coating Ab w/YSRT-MCA1466B) 200ug Ask price € accurate-monoclonals human
YSRTMCA1466B Interleukin 1 Receptor Antagonist (IL-1RA), Clone: 1390, Mouse Monoclonal antibody-Human, Biotin; frozen, IH/ELISA (detect Ab w/YSRT-MCA1467) 200ug Ask price € accurate-monoclonals human
BMA1384-92-17-8 Interleukin 1 Receptor Antagonist (IL-1RA), Clone: 3184.92.17.8, Mouse Monoclonal antibody-Human 0.2mg 1113 € accurate-monoclonals human
BMA1384-92-17-8B Interleukin 1 Receptor Antagonist (IL-1RA), Clone: 3184.92.17.8, Mouse Monoclonal antibody-Human, Biotin 0.2mg 1245 € accurate-monoclonals human
AE38368MO Mouse Interleukin 1 receptor antagonist (IL-1ra) ELISA Kit 48 wells plate 515 € ab-elisa elisas mouse
AE38368MO-96 Mouse Interleukin 1 receptor antagonist (IL-1ra) ELISA Kit 1x plate of 96 wells 671 € abebio mouse
GENTAUR-58be20011af76 Anti-human IL 1 receptor antagonist (hIL-1ra) 500ug 453 € MBS mono human
GENTAUR-58be2000beca5 Anti-human IL 1 receptor antagonist (hIL-1ra) Antibody 500ug 453 € MBS mono human
AE38367PI-48 ELISA test for Pig Interleukin 1 receptor antagonist (IL-1ra) 1x plate of 48 wells 402 € abebio pig
AE38365RA-48 ELISA test for Rat Interleukin 1 receptor antagonist ( IL-1ra) 1x plate of 48 wells 402 € abebio rat
AE38367PI Pig Interleukin 1 receptor antagonist (IL-1ra) ELISA Kit 96 wells plate 810 € ab-elisa elisas pig
AE38367PI-96 Pig Interleukin 1 receptor antagonist (IL-1ra) ELISA Kit 1x plate of 96 wells 671 € abebio pig
KT-56500 Rabbit Interleukin 1 Receptor Antagonist (IL-1RA) ELISA kit 96 well plate 1091 € Kamiya human
AE38365RA Rat Interleukin 1 receptor antagonist ( IL-1ra) ELISA Kit 48 wells plate 500 € ab-elisa elisas rat
AE38365RA-96 Rat Interleukin 1 receptor antagonist ( IL-1ra) ELISA Kit 1x plate of 96 wells 671 € abebio rat
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
GWB-4B6009 Recombinant Mouse Interleukin-1 Receptor Antagonist bulk Ask price € genways bulk mouse
abx260084 Anti-IL 1RA His Protein (Recombinant) 50 µg 804 € abbex human
abx261624 Anti-IL 1RA His Protein (Recombinant) 5 µg 238 € abbex human
abx263163 Anti-IL 1RA Protein (Recombinant) 100 µg 340 € abbex human
RP-0887H Recombinant Human IL-1RA / IL1RN Protein 100μg 346 € adv human
RP-0886H Recombinant Human IL-1RA / IL1RN Protein (Fc Tag) 20μg 508 € adv human
GWB-P0143M Interleukin-1 receptor antagonist, Human, Recombinant Protein bulk Ask price € genways bulk human
C071 Recombinant Human IL-36 Receptor Antagonist Protein, IL-36RN, IL-1F5 1 mg 2283 € novo human
GWB-BIG002 Recombinant Human IL-1Ra bulk Ask price € genways bulk human
MBS622505 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Ox-1-R, Ox1-R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) Antibody 100ug 652 € MBS Polyclonals_1 human
6483 Recombinant Bovine IL-1 Receptor Antagonist 5 µg 220 € Immunochemistry kits bovine