| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human IL-36RA is produced by our E, coli expression system and the target gene encoding Met1-Asp155 is expressed |
| Molecular Weight: |
16, 9 kD |
| UniProt number: |
Q9UBH0 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM TrisHCl, 5, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
IL-1F5, IL-36RN, IL-36 Receptor Antagonist Protein |
| Short name: |
IL-1F5, IL-36RN, Recombinant IL-36 Receptor Antagonist Protein |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
Interleukin-1F5, Interleukin-36RN, sapiens Interleukin-36 Receptor Antagonist Protein, recombinant H |
| Alternative technique: |
rec |
| Identity: |
15561 |
| Gene: |
IL36RN |
More about : IL36RN |
| Long gene name: |
interleukin 36 receptor antagonist |
| Synonyms gene: |
IL1F5 |
| Synonyms gene name: |
interleukin 1 family, member 5 (delta) |
| Synonyms: |
FIL1 FIL1(DELTA) FIL1D IL1HY1 IL1RP3 IL1L1 IL-1F5 IL36RA MGC29840 |
| Synonyms name: |
family of interleukin 1-delta interleukin-1 receptor antagonist homolog 1 interleukin-1 HY1 IL-1 related protein 3 |
| Locus: |
2q14, 1 |
| Discovery year: |
2002-08-02 |
| GenBank acession: |
AF201830 |
| Entrez gene record: |
26525 |
| Pubmed identfication: |
10625660 10512743 11574262 |
| RefSeq identity: |
NM_173170 |
| Classification: |
Interleukins |
| Havana BLAST/BLAT: |
OTTHUMG00000131337 |
| Locus Specific Databases: |
LRG_730 |