Recombinant Mouse PDCD1, PD-1, CD279 (C-6His)

Contact us
Catalog number: CJ98
Price: 406 €
Supplier: NJS poly
Product name: Recombinant Mouse PDCD1, PD-1, CD279 (C-6His)
Quantity: 0.1mg
Other quantities: 1 mg 1268€ 10 µg 100€ 500 µg 902€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Programmed Cell Death Protein 1 is produced by our Mammalian expression system and the target gene encoding Leu25-Gln167 is expressed with a 6His tag at the C-terminus
Molecular Weight: 17, 2 kD
UniProt number: Q02242
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0, pH8
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CD279 (C-6His), PD-1, PDCD1
Short name: CD279 (C-6His), PD-1, Recombinant Mouse PDCD1
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: CD279 (C-6His), PD-1, recombinant Mouse programmed cellular death 1
Alternative technique: rec
Alternative to gene target: CD279 and hPD-1 and hPD-l and hSLE1 and PD-1 and PD1 and SLEB2, Cell surfaces, PDCD1 and IDBG-642702 and ENSBTAG00000011543 and 613842, PDCD1 and IDBG-85346 and ENSG00000188389 and 5133, Pdcd1 and IDBG-184148 and ENSMUSG00000026285 and 18566, protein binding, this GO :0004871 and signal transducer activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0006959 and humoral immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0031295 and T cell costimulation and biological process this GO :0045087 and innate immune response and biological process, this GO :0004871 : signal transducer activity, this GO :0004871 : signal transducer activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, programmed cell death 1
Identity: 8760
Gene: PDCD1 | More about : PDCD1
Long gene name: programmed cell death 1
Synonyms gene: SLEB2
Synonyms gene name: systemic lupus erythematosus susceptibility 2
Synonyms: CD279 PD1 hSLE1 PD-1
Locus: 2q37, 3
Discovery year: 1994-05-24
GenBank acession: AY206416
Entrez gene record: 5133
Pubmed identfication: 7851902 12402038
RefSeq identity: NM_005018
Classification: CD molecules V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000151342

Related Products :

CJ98 Recombinant Mouse PDCD1, PD-1, CD279 (C-6His) 10 µg 100 € novo mouse
CM98 Recombinant Cynomolgus PDCD1, PD-1, CD279 (C-6His) 10 µg 146 € novo human
CD91 Recombinant Human PDCD1, PD-1, CD279 (C-6His) 10 µg 146 € novo human
CM82 Recombinant Human PDCD1, PD-1, CD279 (C93S Mutant, C-6His) 10 µg 156 € novo human
CJ97 Recombinant Mouse PDCD1, PD-1, CD279 (C-Fc) 1 mg 1674 € novo mouse
CM81 Recombinant Human PDCD1, PD-1, CD279 (C-Fc) 10 µg 126 € novo human
C754 Recombinant Human PDCD1, PD-1, CD279 (C-mFc) 50 µg 303 € novo human
GENTAUR-58bde7a2a8757 Mouse Monoclonal [clone J116] (IgG1,k) to Human PDCD1 / CD279 / PD-1 Antibody 50ug 597 € MBS mono human
MBS240383 Anti-Human PDCD1 / CD279 / PD-1 Antibody 50ug 597 € MBS Polyclonals_1 human
MBS241303 Anti-Human PDCD1 / CD279 / PD-1 Antibody 50ug 597 € MBS Polyclonals_1 human
MBS242092 Anti-Human PDCD1 / CD279 / PD-1 Antibody 50ug 597 € MBS Polyclonals_1 human
MBS242109 Goat Polyclonal to Human PDCD1 / CD279 / PD-1 Antibody 50ug 597 € MBS Polyclonals_1 human
RP-1440M Recombinant Mouse PD1 / PDCD1 Protein (His & Fc Tag) 100μg 624 € adv mouse
RP-1439M Recombinant Mouse PD1 / PDCD1 Protein (His Tag) 100μg 624 € adv mouse
RP-1174H Recombinant Human PD1 / PDCD1 Protein (His & Fc Tag) 50μg 624 € adv human
RP-1175H Recombinant Human PD1 / PDCD1 Protein (His Tag) 50μg 624 € adv human
abx152666 Anti-Human PDCD1 ELISA Kit inquire 50 € abbex human
abx571544 Anti-Human PDCD1 ELISA Kit inquire 50 € abbex human
GENTAUR-58bdfda0da219 Anti- PDCD1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdfda1b3fe1 Anti- PDCD1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be46be72028 Anti- PDCD1 Antibody 100ug 393 € MBS Polyclonals human
GENTAUR-58be4dab8af34 Anti- PDCD1 Antibody 0.2 mg 663 € MBS Polyclonals human
GENTAUR-58be4dabed10a Anti- PDCD1 Antibody 50ug 365 € MBS Polyclonals human
abx928032 Anti-PDCD1 siRNA 15 nmol 528 € abbex human
abx928033 Anti-PDCD1 siRNA 30 nmol 717 € abbex human
GWB-B81DA9 antibody to or anti-Programmed Cell Death 1 (PDCD1) antibody 1 vial 573 € genways human
MBS420415 Goat anti-PDCD1 Antibody 100ug 370 € MBS Polyclonals_1 human
DL-PDCD1-Hu Human Programmed Cell Death Protein 1 PDCD1 ELISA Kit 96T 846 € DL elisas human
GWB-BSP937 PDCD1 Antibody bulk Ask price € genways bulk human
R34081-100UG PDCD1 Antibody 0.1mg 406 € NJS poly human