| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Programmed Cell Death Protein 1 is produced by our Mammalian expression system and the target gene encoding Leu25-Gln167 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
1 kD, 43 |
| UniProt number: |
Q15116 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDSRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
C-6His), CD279 (C93S Mutant, PD-1, PDCD1 |
| Short name: |
C-6His), CD279 (C93S Mutant, PD-1, Recombinant PDCD1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
C-6His), CD279 (C93S Mutant, PD-1, sapiens programmed cellular death 1, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD279 and hPD-1 and hPD-l and hSLE1 and PD-1 and PD1 and SLEB2, Cell surfaces, PDCD1 and IDBG-642702 and ENSBTAG00000011543 and 613842, PDCD1 and IDBG-85346 and ENSG00000188389 and 5133, Pdcd1 and IDBG-184148 and ENSMUSG00000026285 and 18566, protein binding, this GO :0004871 and signal transducer activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0006959 and humoral immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0031295 and T cell costimulation and biological process this GO :0045087 and innate immune response and biological process, this GO :0004871 : signal transducer activity, this GO :0004871 : signal transducer activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, programmed cell death 1 |
| Identity: |
8760 |
| Gene: |
PDCD1 |
More about : PDCD1 |
| Long gene name: |
programmed cell death 1 |
| Synonyms gene: |
SLEB2 |
| Synonyms gene name: |
systemic lupus erythematosus susceptibility 2 |
| Synonyms: |
CD279 PD1 hSLE1 PD-1 |
| Locus: |
2q37, 3 |
| Discovery year: |
1994-05-24 |
| GenBank acession: |
AY206416 |
| Entrez gene record: |
5133 |
| Pubmed identfication: |
7851902 12402038 |
| RefSeq identity: |
NM_005018 |
| Classification: |
CD molecules V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000151342 |