| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Cathepsin B is produced by our Mammalian expression system and the target gene encoding His18-Phe339 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
36, 4 kD |
| UniProt number: |
P10605 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
HDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAANSWNLDWGDNGFFKILRGENHCGIESEIVAGIPRTDQYWGRFVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Gene: |
CTSB |
More about : CTSB |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
CTSB (C-6His), Cathepsin B |
| Short name: |
CTSB (C-6His), Recombinant Mouse Cathepsin B |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
cathepsin B (C-6His), recombinant Mouse Cathepsin B |
| Alternative technique: |
rec |
| Alternative to gene target: |
APPS and CPSB, CTSB and IDBG-629395 and ENSBTAG00000012442 and 281105, CTSB and IDBG-7654 and ENSG00000164733 and 1508, Ctsb and IDBG-172314 and ENSMUSG00000021939 and 13030, nuclei, proteoglycan binding, this GO :0002224 and toll-like receptor signaling pathway and biological process this GO :0004197 and cysteine-type endopeptidase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005518 and collagen binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005622 and intracellular and cellular component this GO :0005730 and nucleolus and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005764 and lysosome and cellular component this GO :0006508 and proteolysis and biological process this GO :0008233 and peptidase activity and molecular function this GO :0008234 and cysteine-type peptidase activity and molecular function this GO :0022617 and extracellular matrix disassembly and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030574 and collagen catabolic process and biological process this GO :0030855 and epithelial cell differentiation and biological process this GO :0036021 and endolysosome lumen and cellular component this GO :0042470 and melanosome and cellular component this GO :0042981 and regulation of apoptotic process and biological process this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0043394 and proteoglycan binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0046697 and decidualization and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0050790 and regulation of catalytic activity and biological process this GO :0051603 and proteolysis involved in cellular protein catabolic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0097067 and cellular response to thyroid hormone stimulus and biological process, this GO :0004197 : cysteine-type endopeptidase activity, this GO :0004197 : cysteine-type endopeptidase activity and also this GO :0005515 : protein binding and also this GO :0005518 : collagen binding and also this GO :0008233 : peptidase activity and also this GO :0008234 : cysteine-type peptidase activity and also this GO :0043394 : proteoglycan binding, this GO :0005515 : protein binding, this GO :0005518 : collagen binding, this GO :0008233 : peptidase activity, this GO :0008234 : cysteine-type peptidase activity, this GO :0043394 : proteoglycan binding, cathepsin B |
| Identity: |
2527 |
| Long gene name: |
cathepsin B |
| Locus: |
8p23, 1 |
| Discovery year: |
2001-06-22 |
| GenBank acession: |
M14221 |
| Entrez gene record: |
1508 |
| Pubmed identfication: |
8112600 3463996 |
| RefSeq identity: |
NM_147780 |
| Classification: |
Cathepsins |
| Havana BLAST/BLAT: |
OTTHUMG00000090799 |