Recombinant Mouse Cathepsin B, CTSB (C-6His)

Contact us
Catalog number: CJ65
Price: 888 €
Supplier: Biomatik ELISA kits
Product name: Recombinant Mouse Cathepsin B, CTSB (C-6His)
Quantity: 1 plate of 96 wells
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Cathepsin B is produced by our Mammalian expression system and the target gene encoding His18-Phe339 is expressed with a 6His tag at the C-terminus
Molecular Weight: 36, 4 kD
UniProt number: P10605
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: HDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAANSWNLDWGDNGFFKILRGENHCGIESEIVAGIPRTDQYWGRFVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Gene: CTSB | More about : CTSB
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CTSB (C-6His), Cathepsin B
Short name: CTSB (C-6His), Recombinant Mouse Cathepsin B
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: cathepsin B (C-6His), recombinant Mouse Cathepsin B
Alternative technique: rec
Alternative to gene target: APPS and CPSB, CTSB and IDBG-629395 and ENSBTAG00000012442 and 281105, CTSB and IDBG-7654 and ENSG00000164733 and 1508, Ctsb and IDBG-172314 and ENSMUSG00000021939 and 13030, nuclei, proteoglycan binding, this GO :0002224 and toll-like receptor signaling pathway and biological process this GO :0004197 and cysteine-type endopeptidase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005518 and collagen binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005622 and intracellular and cellular component this GO :0005730 and nucleolus and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005764 and lysosome and cellular component this GO :0006508 and proteolysis and biological process this GO :0008233 and peptidase activity and molecular function this GO :0008234 and cysteine-type peptidase activity and molecular function this GO :0022617 and extracellular matrix disassembly and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030574 and collagen catabolic process and biological process this GO :0030855 and epithelial cell differentiation and biological process this GO :0036021 and endolysosome lumen and cellular component this GO :0042470 and melanosome and cellular component this GO :0042981 and regulation of apoptotic process and biological process this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0043394 and proteoglycan binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0046697 and decidualization and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0050790 and regulation of catalytic activity and biological process this GO :0051603 and proteolysis involved in cellular protein catabolic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0097067 and cellular response to thyroid hormone stimulus and biological process, this GO :0004197 : cysteine-type endopeptidase activity, this GO :0004197 : cysteine-type endopeptidase activity and also this GO :0005515 : protein binding and also this GO :0005518 : collagen binding and also this GO :0008233 : peptidase activity and also this GO :0008234 : cysteine-type peptidase activity and also this GO :0043394 : proteoglycan binding, this GO :0005515 : protein binding, this GO :0005518 : collagen binding, this GO :0008233 : peptidase activity, this GO :0008234 : cysteine-type peptidase activity, this GO :0043394 : proteoglycan binding, cathepsin B
Identity: 2527
Long gene name: cathepsin B
Locus: 8p23, 1
Discovery year: 2001-06-22
GenBank acession: M14221
Entrez gene record: 1508
Pubmed identfication: 8112600 3463996
RefSeq identity: NM_147780
Classification: Cathepsins
Havana BLAST/BLAT: OTTHUMG00000090799

Related Products :

CJ65 Recombinant Mouse Cathepsin B, CTSB (C-6His) 50 µg 496 € novo mouse
C398 Recombinant Human Cathepsin B, CTSB (C-6His) 1 mg 2283 € novo human
MBS624515 CTSH, NT (Cathepsin H, Cathepsin H Mini Chain, Cathepsin H Heavy Chain, Cathepsin H Light Chain, CPSB) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS624507 CTSK (ID R222) (Cathepsin K, Cathepsin O, Cathepsin X, Cathepsin O2, CTSO2, CTSO) Antibody 200ul 603 € MBS Polyclonals_1 human
RP-1077M Recombinant Mouse Cathepsin B / CTSB Protein (His Tag) 10μg 624 € adv mouse
CTHB16-N-10 Recombinant (HEK) Human Cathepsin B (CTSB) protein (18-339 aa, His-tag, >95%, low endotoxins 10 μg 405 € adi human
RP-0222H Recombinant Human Cathepsin B / CTSB Protein (His Tag) 10μg 624 € adv human
abx571764 Anti-Mouse Cathepsin B (CTSB) ELISA Kit 96 tests 804 € abbex mouse
AE48458MO-48 ELISA test for Mouse Cathepsin B (CTSB) 1x plate of 48 wells 373 € abebio mouse
AE48458MO-96 Mouse Cathepsin B (CTSB) ELISA Kit 1x plate of 96 wells 612 € abebio mouse
DL-CTSB-Mu Mouse Cathepsin B CTSB ELISA Kit 96T 921 € DL elisas mouse
MBS624238 CTSE, ID (Cathepsin E, Cathepsin E form I, Cathepsin E form II) Antibody 200ul 603 € MBS Polyclonals_1 human
GENTAUR-58bdc2b71137c Anti- Cathepsin B (CTSB) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdc2b759d72 Anti- Cathepsin B (CTSB) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdc58b7c2ad Anti- Cathepsin B (CTSB) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc58bca955 Anti- Cathepsin B (CTSB) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdcbfe4c5e4 Anti- Cathepsin B (CTSB) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdcbfebc8ad Anti- Cathepsin B (CTSB) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdd1ad57ff0 Anti- Cathepsin B (CTSB) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdd21940343 Anti- Cathepsin B (CTSB) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd36cc5ece Anti- Cathepsin B (CTSB) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd64740997 Anti- Cathepsin B (CTSB) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd675a50a9 Anti- Cathepsin B (CTSB) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58bdd6cb0a18a Anti- Cathepsin B (CTSB) Antibody 100ug 603 € MBS Polyclonals human
abx572408 Anti-Human Cathepsin B (CTSB) ELISA Kit 96 tests 789 € abbex human
MBS248791 Anti-Human CTSB / Cathepsin B Antibody 50ug 597 € MBS Polyclonals_1 human
abx571768 Anti-Rat Cathepsin B (CTSB) ELISA Kit inquire 50 € abbex rat
EKU03021 Cathepsin B (CTSB) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
EKU03022 Cathepsin B (CTSB) ELISA kit 1 plate of 96 wells 844 € Biomatik ELISA kits human
EKU03023 Cathepsin B (CTSB) ELISA kit 1 plate of 96 wells 888 € Biomatik ELISA kits human