Recombinant Mouse Ephrin-B1, EFNB1 (C-Fc-6His)

Contact us
Catalog number: CJ23
Price: 212 €
Supplier: novo
Product name: Recombinant Mouse Ephrin-B1, EFNB1 (C-Fc-6His)
Quantity: 50 µg
Other quantities: 1 mg 608€ 10 µg 80€ 500 µg 461€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: 6His tag at the C-terminus, Recombinant Mouse Ephrin-B1 is produced by our Mammalian expression system and the target gene encoding Lys30-Ser229 is expressed with a Fc
Molecular Weight: 49, 8 kD
UniProt number: P52795
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: KNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPHQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQEEKSGPGAGGGGSGDSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: EFNB1 (C-Fc-6His), Ephrin-B1
Short name: EFNB1 (C-Fc-6His), Recombinant Mouse Ephrin-B1
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: ephrin-B1 (C-fragment c-6His), recombinant Mouse Ephrin-B1
Alternative technique: rec
Alternative to gene target: CFND and CFNS and EFB1 and EFL3 and Elk-L and EPLG2 and LERK2, EFNB1 and IDBG-636377 and ENSBTAG00000015801 and 534413, EFNB1 and IDBG-74050 and ENSG00000090776 and 1947, Efnb1 and IDBG-161815 and ENSMUSG00000031217 and 13641, ephrin receptor binding, nuclei, this GO :0001755 and neural crest cell migration and biological process this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0007411 and axon guidance and biological process this GO :0009880 and embryonic pattern specification and biological process this GO :0016020 and membrane and cellular component this GO :0042102 and positive regulation of T cell proliferation and biological process this GO :0045121 and membrane raft and cellular component this GO :0045202 and synapse and cellular component this GO :0046875 and ephrin receptor binding and molecular function this GO :0048013 and ephrin receptor signaling pathway and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0046875 : ephrin receptor binding, this GO :0046875 : ephrin receptor binding, ephrin-B1
Identity: 3226
Gene: EFNB1 | More about : EFNB1
Long gene name: ephrin B1
Synonyms gene: EPLG2 CFNS
Synonyms gene name: craniofrontonasal syndrome (craniofrontonasal dysplasia) ephrin-B1
Synonyms: LERK2 Elk-L
Locus: Xq13, 1
Discovery year: 1995-01-17
GenBank acession: U09303
Entrez gene record: 1947
Pubmed identfication: 7774950 16526919
RefSeq identity: NM_004429
Classification: Ephrins
Havana BLAST/BLAT: OTTHUMG00000021751
Locus Specific Databases: Mental Retardation database

Related Products :

CJ23 Recombinant Mouse Ephrin-B1, EFNB1 (C-Fc-6His) 500 µg 461 € novo mouse
CC54 Recombinant Human Ephrin-B1, EFNB1 (C-6His) 10 µg 146 € novo human
RP-0595H Recombinant Human Ephrin-B1 / EFNB1 Protein (His & Fc Tag) 50μg 572 € adv human
MBS623300 EphA4 (Ephrin Receptor Eph A4, Ephrin Receptor EphA4, Ephrin Type A Receptor 4, EPH Receptor A4, Eph A4, EPH-like Kinase 8, EK8, HEK8, Receptor Protein Tyrosine Kinase HEK8, SEK, TYRO1 Protein Tyrosine Kinase, Tyrosine Protein Kinase Receptor SEK, Tyrosin Antibody 50ug 928 € MBS Polyclonals_1 human
MBS610892 Ephrin-A5 (ephrin-A5, AF1, AL-1, EFL5, EPH- related receptor tyrosine kinase ligand 7, Ephrin-A5 precursor, EPLG7, GLC1M, LERK7, LERK-7, RAGS) Antibody 50ug 625 € MBS Polyclonals_1 human
MBS613613 Ephrin-A5 (ephrin-A5, AF1, AL-1, EFL5, EPH- related receptor tyrosine kinase ligand 7, Ephrin-A5 precursor, EPLG7, GLC1M, LERK7, LERK-7, RAGS) Antibody 100ug 663 € MBS Polyclonals_1 human
MBS615500 Ephrin B3 (EFNB3, Ephrin B3 (EFL6, EPH-related receptor transmembrane ligand ELK-L3, EPH-related receptor tyrosine kinase ligand 8, Ephrin-B3, EPLG8, LERK8) Antibody 100ug 663 € MBS Polyclonals_1 human
EKU03924 Ephrin B1 (EFNB1) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
GENTAUR-58baf8ee85bbf Human Ephrin-B1 (EFNB1) 100ug 1641 € MBS Recombinant Proteins human
GENTAUR-58baf8eed35e1 Human Ephrin-B1 (EFNB1) 1000ug 1641 € MBS Recombinant Proteins human
GENTAUR-58baf8ef2fea6 Human Ephrin-B1 (EFNB1) 100ug 2155 € MBS Recombinant Proteins human
GENTAUR-58baf8ef818fb Human Ephrin-B1 (EFNB1) 1000ug 2155 € MBS Recombinant Proteins human
GENTAUR-58bb2557c49fc Human Ephrin-B1 (EFNB1) 100ug 1641 € MBS Recombinant Proteins human
GENTAUR-58bb255828691 Human Ephrin-B1 (EFNB1) 1000ug 1641 € MBS Recombinant Proteins human
GENTAUR-58bb255882ee6 Human Ephrin-B1 (EFNB1) 100ug 2155 € MBS Recombinant Proteins human
GENTAUR-58bb2558daa6d Human Ephrin-B1 (EFNB1) 1000ug 2155 € MBS Recombinant Proteins human
GENTAUR-58ba8eb3a6ac5 Xenopus laevis Ephrin-B1 (efnb1) 100ug 1630 € MBS Recombinant Proteins xenopus
GENTAUR-58ba8eb44035d Xenopus laevis Ephrin-B1 (efnb1) 1000ug 1630 € MBS Recombinant Proteins xenopus
GENTAUR-58ba8eb4b9771 Xenopus laevis Ephrin-B1 (efnb1) 100ug 2144 € MBS Recombinant Proteins xenopus
GENTAUR-58ba8eb5295b2 Xenopus laevis Ephrin-B1 (efnb1) 1000ug 2144 € MBS Recombinant Proteins xenopus
CD74 Recombinant Mouse Ephrin-A1, EFNA1 (C-Fc-6His) 1 mg 659 € novo mouse
CD23 Recombinant Mouse Ephrin-A5, EFNA5 (C-6His) 10 µg 146 € novo mouse
CD70 Recombinant Mouse Ephrin-B2, EFNB2 (C-Fc-6His) 1 mg 659 € novo mouse
GWB-P0845M EFNB1, 28-237aa, Recombinant Protein bulk Ask price € genways bulk human
CS02 Recombinant Human Ephrin A Receptor 1, EphA1 (Lys26-Glu547, C-6His) 50 µg 303 € novo human
CS03 Recombinant Human Ephrin A Receptor 2, EphA2 (C-6His) 50 µg 202 € novo human
C519 Recombinant Human Ephrin A Receptor 7, EphA7 (C-6His) 10 µg 141 € novo human
CA70 Recombinant Human Ephrin-A1, EFNA1, LERK-1 (C-6His) 10 µg 156 € novo human
C464 Recombinant Human Ephrin-A3, EFNA3(C-6His) 50 µg 131 € novo human
C466 Recombinant Human Ephrin-A4, EFNA4 (C-6His) 50 µg 212 € novo human