| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Syndecan-4 is produced by our Mammalian expression system and the target gene encoding Glu24-Glu145 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
14, 4 kD |
| UniProt number: |
O35988 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
ESIRETEVIDPQDLLEGRYFSGALPDDEDAGGSDDFELSGSGDLDDTEEPRPFPEVIEPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRAPSDVGDDMSNKVSMSSTAQGSNIFERTEVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
SDC4 (C-6His), Syndecan-4 |
| Short name: |
SDC4 (C-6His), Recombinant Mouse Syndecan-4 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
syndecan 4 (C-6His), recombinant Mouse Syndecan-4 |
| Alternative technique: |
rec |
| Alternative to gene target: |
Cell surfaces, SDC4 and IDBG-642873 and ENSBTAG00000015127 and 508133, SDC4 and IDBG-77503 and ENSG00000124145 and 6385, SYND4, Sdc4 and IDBG-212144 and ENSMUSG00000017009 and 20971, this GO :0001523 and retinoid metabolic process and biological process this GO :0001657 and ureteric bud development and biological process this GO :0001968 and fibronectin binding and molecular function this GO :0005080 and protein kinase C binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005796 and this GO lgi lumen and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0005925 and focal adhesion and cellular component this GO :0005975 and carbohydrate metabolic process and biological process this GO :0006024 and glycosaminoglycan biosynthetic process and biological process this GO :0006027 and glycosaminoglycan catabolic process and biological process this GO :0007603 and phototransduction, this GO :0001968 : fibronectin binding, this GO :0001968 : fibronectin binding and also this GO :0005080 : protein kinase C binding and also this GO :0005515 : protein binding and also this GO :0008092 : cytoskeletal protein binding and also this GO :0070053 : thrombospondin receptor activity, this GO :0005080 : protein kinase C binding, this GO :0005515 : protein binding, this GO :0008092 : cytoskeletal protein binding, this GO :0070053 : thrombospondin receptor activity, thrombospondin receptor activity, visible light and biological process this GO :0008092 and cytoskeletal protein binding and molecular function this GO :0008150 and biological process and biological process this GO :0009986 and cell surface and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0030198 and extracellular matrix organization and biological process this GO :0030203 and glycosaminoglycan metabolic process and biological process this GO :0030204 and chondroitin sulfate metabolic process and biological process this GO :0043034 and costamere and cellular component this GO :0043202 and lysosomal lumen and cellular component this GO :0044281 and small molecule metabolic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045121 and membrane raft and cellular component this GO :0045860 and positive regulation of protein kinase activity and biological process this GO :0051496 and positive regulation of stress fiber assembly and biological process this GO :0051894 and positive regulation of focal adhesion assembly and biological process this GO :0070053 and thrombospondin receptor activity and molecular function this GO :0070062 and extracellular vesicular exosome and cellular component, syndecan 4 |
| Identity: |
10661 |
| Gene: |
SDC4 |
More about : SDC4 |
| Long gene name: |
syndecan 4 |
| Synonyms gene name: |
ryudocan) , syndecan 4 (amphiglycan |
| Synonyms: |
SYND4 amphiglycan ryudocan |
| Synonyms name: |
syndecan proteoglycan 4 |
| Locus: |
20q13, 12 |
| Discovery year: |
1994-05-17 |
| GenBank acession: |
X67016 D13292 |
| Entrez gene record: |
6385 |
| Pubmed identfication: |
7916598 1500433 |
| RefSeq identity: |
NM_002999 |
| Classification: |
Syndecans |
| Havana BLAST/BLAT: |
OTTHUMG00000033083 |