Recombinant Mouse Syndecan-4, SDC4 (C-6His)

Contact us
Catalog number: CJ11
Price: 1940 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Mouse Syndecan-4, SDC4 (C-6His)
Quantity: 1000ug
Other quantities: 10 µg 100€ 50 µg 202€ 500 µg 780€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Syndecan-4 is produced by our Mammalian expression system and the target gene encoding Glu24-Glu145 is expressed with a 6His tag at the C-terminus
Molecular Weight: 14, 4 kD
UniProt number: O35988
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: ESIRETEVIDPQDLLEGRYFSGALPDDEDAGGSDDFELSGSGDLDDTEEPRPFPEVIEPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRAPSDVGDDMSNKVSMSSTAQGSNIFERTEVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: SDC4 (C-6His), Syndecan-4
Short name: SDC4 (C-6His), Recombinant Mouse Syndecan-4
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: syndecan 4 (C-6His), recombinant Mouse Syndecan-4
Alternative technique: rec
Alternative to gene target: Cell surfaces, SDC4 and IDBG-642873 and ENSBTAG00000015127 and 508133, SDC4 and IDBG-77503 and ENSG00000124145 and 6385, SYND4, Sdc4 and IDBG-212144 and ENSMUSG00000017009 and 20971, this GO :0001523 and retinoid metabolic process and biological process this GO :0001657 and ureteric bud development and biological process this GO :0001968 and fibronectin binding and molecular function this GO :0005080 and protein kinase C binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005796 and this GO lgi lumen and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0005925 and focal adhesion and cellular component this GO :0005975 and carbohydrate metabolic process and biological process this GO :0006024 and glycosaminoglycan biosynthetic process and biological process this GO :0006027 and glycosaminoglycan catabolic process and biological process this GO :0007603 and phototransduction, this GO :0001968 : fibronectin binding, this GO :0001968 : fibronectin binding and also this GO :0005080 : protein kinase C binding and also this GO :0005515 : protein binding and also this GO :0008092 : cytoskeletal protein binding and also this GO :0070053 : thrombospondin receptor activity, this GO :0005080 : protein kinase C binding, this GO :0005515 : protein binding, this GO :0008092 : cytoskeletal protein binding, this GO :0070053 : thrombospondin receptor activity, thrombospondin receptor activity, visible light and biological process this GO :0008092 and cytoskeletal protein binding and molecular function this GO :0008150 and biological process and biological process this GO :0009986 and cell surface and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0030198 and extracellular matrix organization and biological process this GO :0030203 and glycosaminoglycan metabolic process and biological process this GO :0030204 and chondroitin sulfate metabolic process and biological process this GO :0043034 and costamere and cellular component this GO :0043202 and lysosomal lumen and cellular component this GO :0044281 and small molecule metabolic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045121 and membrane raft and cellular component this GO :0045860 and positive regulation of protein kinase activity and biological process this GO :0051496 and positive regulation of stress fiber assembly and biological process this GO :0051894 and positive regulation of focal adhesion assembly and biological process this GO :0070053 and thrombospondin receptor activity and molecular function this GO :0070062 and extracellular vesicular exosome and cellular component, syndecan 4
Identity: 10661
Gene: SDC4 | More about : SDC4
Long gene name: syndecan 4
Synonyms gene name: ryudocan) , syndecan 4 (amphiglycan
Synonyms: SYND4 amphiglycan ryudocan
Synonyms name: syndecan proteoglycan 4
Locus: 20q13, 12
Discovery year: 1994-05-17
GenBank acession: X67016 D13292
Entrez gene record: 6385
Pubmed identfication: 7916598 1500433
RefSeq identity: NM_002999
Classification: Syndecans
Havana BLAST/BLAT: OTTHUMG00000033083

Related Products :

CJ11 Recombinant Mouse Syndecan-4, SDC4 (C-6His) 10 µg 100 € novo mouse
RP-1536M Recombinant Mouse Syndecan-4 / SDC4 Protein (Fc Tag) 50μg 624 € adv mouse
RP-1537M Recombinant Mouse Syndecan-4 / SDC4 Protein (His Tag) 50μg 624 € adv mouse
abx573857 Anti-Human Syndecan 4 (SDC4) ELISA Kit inquire 50 € abbex human
abx572352 Anti-Rat Syndecan 4 (SDC4) ELISA Kit inquire 50 € abbex rat
AR09367PU-L anti-Syndecan-4 (SDC4) (19-145) Antibody 0,5 mg 2225 € acr human
AR09367PU-N anti-Syndecan-4 (SDC4) (19-145) Antibody 0,1 mg 804 € acr human
AP00296PU-N anti-Syndecan-4 (SDC4) Antibody 0,1 mg 659 € acr human
AP01356PU-N anti-Syndecan-4 (SDC4) Antibody 0,1 mg 558 € acr human
B1010-1 anti-Syndecan-4 (SDC4) Antibody 50 Вµg 347 € acr human
B1010-2 anti-Syndecan-4 (SDC4) Antibody 0,1 mg 500 € acr human
GENTAUR-58bdc512c4ddb Anti- Syndecan 4 (SDC4) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdcdc4ccd59 Anti- Syndecan 4 (SDC4) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdcdc5490b0 Anti- Syndecan 4 (SDC4) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdce4ab5e02 Anti- Syndecan 4 (SDC4) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdce9530679 Anti- Syndecan 4 (SDC4) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdce95ab1b8 Anti- Syndecan 4 (SDC4) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdd5a7f06ca Anti- Syndecan 4 (SDC4) Antibody 100ug 580 € MBS Polyclonals human
GENTAUR-58bdd655af70d Anti- Syndecan 4 (SDC4) Antibody 100ug 553 € MBS Polyclonals human
AP53821PU-N anti-Syndecan-4 (SDC4) (Center) Antibody 0,4 ml 587 € acr human
AP00296CP-N anti-Syndecan-4 (SDC4) control peptide Antibody 50 Вµg 326 € acr human
E-EL-Ch0039 Chicken SDC4 (Syndecan 4) ELISA Kit 96T 568 € elabsciences chicken
GENTAUR-58b8ef443d1ef Human Syndecan-4 (SDC4) 100ug 1437 € MBS Recombinant Proteins human
GENTAUR-58b8ef44964cc Human Syndecan-4 (SDC4) 1000ug 1437 € MBS Recombinant Proteins human
GENTAUR-58b8ef44d8585 Human Syndecan-4 (SDC4) 100ug 1940 € MBS Recombinant Proteins human
GENTAUR-58b8ef4537ee9 Human Syndecan-4 (SDC4) 1000ug 1940 € MBS Recombinant Proteins human
GENTAUR-58b9eb602f1c1 Human Syndecan-4 (SDC4) 100ug 1437 € MBS Recombinant Proteins human
GENTAUR-58b9eb6099de5 Human Syndecan-4 (SDC4) 1000ug 1437 € MBS Recombinant Proteins human
GENTAUR-58b9eb610c724 Human Syndecan-4 (SDC4) 100ug 1940 € MBS Recombinant Proteins human
GENTAUR-58b9eb6167483 Human Syndecan-4 (SDC4) 1000ug 1940 € MBS Recombinant Proteins human