Recombinant Mouse Sialic Acid Binding Ig-Like Lectin 3, Siglec-3, CD33 (C-6His)

Contact us
Catalog number: CJ10
Price: 520 €
Supplier: MBS Polyclonals
Product name: Recombinant Mouse Sialic Acid Binding Ig-Like Lectin 3, Siglec-3, CD33 (C-6His)
Quantity: 100ug
Other quantities: 10 µg 156€ 50 µg 369€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Sialic Acid Binding Ig-like Lectin 3 is produced by our Mammalian expression system and the target gene encoding Asp18-Glu240 is expressed with a 6His tag at the C-terminus
Molecular Weight: 25, 7 kD
UniProt number: Q63994
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: DLEFQLVAPESVTVEEGLCVHVPCSVFYPSIKLTLGPVTGSWLRKGVSLHEDSPVATSDPRQLVQKATQGRFQLLGDPQKHDCSLFIRDAQKNDTGMYFFRVVREPFVRYSYKKSQLSLHVTSLSRTPDIIIPGTLEAGYPSNLTCSVPWACEQGTPPTFSWMSTALTSLSSRTTDSSVLTFTPQPQDHGTKLTCLVTFSGAGVTVERTIQLNVTRKSGQMREVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CD33 (C-6His), Siglec-3, Sialic Acid Binding Ig-Like Lectin 3
Short name: CD33 (C-6His), Siglec-3, Recombinant Mouse Sialic Acid Binding Ig-Like Lectin 3
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: CD33 molecule (C-6His), Siglec-3, recombinant Mouse Sialic Acid Binding Ig-Like Lectin 3
Alternative technique: rec
Alternative to gene target: CD33 and IDBG-65737 and ENSG00000105383 and 945, Cell surfaces, p67 and SIGLEC-3 and SIGLEC3, protein binding, this GO :0004872 and receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007165 and signal transduction and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, CD33 molecule
Identity: 1659
Gene: CD33 | More about : CD33
Long gene name: CD33 molecule
Synonyms gene name: CD33 antigen (gp67)
Synonyms: SIGLEC3 SIGLEC-3 p67 FLJ00391
Synonyms name: sialic acid binding Ig-like lectin 3
Locus: 19q13, 41
Discovery year: 1986-01-01
GenBank acession: M23197
Entrez gene record: 945
Pubmed identfication: 3139766 9465907
RefSeq identity: NM_001772
Classification: CD molecules Sialic acid binding Ig like lectins V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000182891

Related Products :

CJ10 Recombinant Mouse Sialic Acid Binding Ig-Like Lectin 3, Siglec-3, CD33 (C-6His) 1 mg 2283 € novo mouse
C445 Recombinant Human Sialic Acid Binding Ig-Like Lectin 3, Siglec-3, CD33 (C-Fc-6His) 500 µg 1613 € novo human
C788 Recombinant Human Sialic Acid-Binding Ig-Like Lectin 9, Siglec 9, CD329 (C-Fc) 10 µg 146 € novo human
MBS623641 SIGLEC8, CT (Sialic Acid-binding Ig-like Lectin 8, Siglec-8, Sialoadhesin Family Member 2, SAF-2, CDw329, CD329, SAF2) 200ul 603 € MBS Polyclonals_1 human
MBS619555 Galectin-1 (GAL1, LGALS1, GAL-1, Lectin galactoside-binding soluble 1, Beta-galactoside- binding lectin L-14-I, Lactose-binding lectin 1, S-Lac lectin 1, Galaptin, 14kD lectin, HPL, HBL, Putative MAPK-activating protein PM12, GBP, DKFZp686E23103) Antibody 100ug 774 € MBS Polyclonals_1 human
MBS620576 Galectin-1 (GAL1, LGALS1, Lectin galactoside-binding soluble 1, Beta-galactoside- binding lectin L-14-I, Lactose-binding lectin 1, S-Lac lectin 1, Galaptin, HPL, HBL, Putative MAPK-activating protein PM12, GBP, DKFZp686E23103) (Biotin) Antibody 50ug 597 € MBS Polyclonals_1 human
GENTAUR-58bde5648af11 MOUSE Anti-HUMAN SIGLEC-5/SIGLEC-14 Antibody 100ug 393 € MBS mono human
GENTAUR-58bde54f55538 MOUSE Anti-HUMAN SIGLEC-5/SIGLEC-14:FITC Antibody 100ug 448 € MBS mono human
GENTAUR-58bde51bb0bc5 MOUSE Anti-HUMAN SIGLEC-5/SIGLEC-14:RPE Antibody 100 Tests 475 € MBS mono human
RP-1127M Recombinant Mouse CD33 / Siglec-3 Protein (Fc Tag) 50μg 624 € adv mouse
RP-1126M Recombinant Mouse CD33 / Siglec-3 Protein (His Tag) 20μg 572 € adv mouse
abx167216 Anti-Sialic Acid Binding Ig Like Lectin 3 Protein (Recombinant) 50 μg 572 € abbex human
abx168235 Anti-Sialic Acid Binding Ig Like Lectin 8 Protein (Recombinant) 50 μg 615 € abbex human
RP-0319H Recombinant Human CD33 / Siglec-3 Protein (Fc Tag) 50μg 624 € adv human
RP-0320H Recombinant Human CD33 / Siglec-3 Protein (His Tag) 50μg 624 € adv human
abx254421 Anti-Mouse Sialic Acid Binding Ig Like Lectin 3 ELISA Kit 96 tests 557 € abbex mouse
MBS622146 Galectin-2 (Beta galactoside binding lectin L14 II, Lactose-binding lectin 2, S-Lac lectin 2, HL14, LGALS2) Antibody 100ul 1199 € MBS Polyclonals_1 human
abx250213 Anti-Human Sialic Acid Binding Ig Like Lectin 1 ELISA Kit 96 tests 557 € abbex human
abx250452 Anti-Human Sialic acid-binding Ig-like lectin 10 ELISA Kit inquire 50 € abbex human
abx253173 Anti-Human Sialic Acid Binding Ig Like Lectin 2 ELISA Kit 96 tests 557 € abbex human
abx253174 Anti-Human Sialic Acid Binding Ig Like Lectin 3 ELISA Kit inquire 50 € abbex human
abx156853 Anti-Human Sialic Acid Binding Ig Like Lectin 6 ELISA Kit inquire 50 € abbex human
abx156745 Anti-Human Sialic Acid Binding Ig Like Lectin 7 ELISA Kit inquire 50 € abbex human
abx253175 Anti-Human Sialic Acid Binding Ig Like Lectin 8 ELISA Kit inquire 50 € abbex human
abx255404 Anti-Monkey Sialic Acid Binding Ig Like Lectin 3 ELISA Kit inquire 50 € abbex monkey
abx128552 Anti-Sialic Acid Binding Ig Like Lectin 1 Antibody 50 μg 383 € abbex human
GENTAUR-58bdc1f666349 Anti- Sialic Acid Binding Ig Like Lectin 1 (SIGLEC1) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdcb8f5c2cd Anti- Sialic Acid Binding Ig Like Lectin 1 (SIGLEC1) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdcb8fbf96e Anti- Sialic Acid Binding Ig Like Lectin 1 (SIGLEC1) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bdd692dba08 Anti- Sialic Acid Binding Ig Like Lectin 1 (SIGLEC1) Antibody 100ug 520 € MBS Polyclonals human