Recombinant Mouse L-Selectin, CD62L (C-6His)

Contact us
Catalog number: CI12
Price: 413 €
Supplier: accurate-monoclonals
Product name: Recombinant Mouse L-Selectin, CD62L (C-6His)
Quantity: 0.5mg
Other quantities: 1 mg 912€ 10 µg 100€ 500 µg 709€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse L-selectin is produced by our Mammalian expression system and the target gene encoding Trp39-Asn332 is expressed with a 6His tag at the C-terminus
Molecular Weight: 1 kD, 34
UniProt number: P18337
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: WTYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYNVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CD62L (C-6His), L-Selectin
Short name: CD62L (C-6His), Recombinant Mouse L-Selectin
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: CD62L (C-6His), recombinant Mouse L-Selectin
Alternative technique: rec
Identity: 10720
Gene: SELL | More about : SELL
Long gene name: selectin L
Synonyms gene: LYAM1 LNHR
Synonyms gene name: lymphocyte adhesion molecule 1
Synonyms: LSEL LAM1 LAM-1 hLHRc Leu-8 Lyam-1 PLNHR CD62L
Locus: 1q24, 2
Discovery year: 1989-06-07
GenBank acession: M25280
Entrez gene record: 6402
Pubmed identfication: 2664786 1375831
RefSeq identity: NM_000655
Classification: Sushi domain containing Selectins CD molecules C-type lectin domain containing
Havana BLAST/BLAT: OTTHUMG00000034809

Related Products :

CI12 Recombinant Mouse L-Selectin, CD62L (C-6His) 1 mg 912 € novo mouse
CB49 Recombinant Human L-Selectin, CD62L (C-6His) 10 µg 100 € novo human
RP-1153M Recombinant Mouse CD62L / L-Selectin / SELL Protein (His & Fc Tag) 100μg 624 € adv mouse
RP-1152M Recombinant Mouse CD62L / L-Selectin / SELL Protein (His Tag) 100μg 624 € adv mouse
MAS871c CD62L, L-Selectin, LECAM-1, LAM-1, Clone: MEL-14, Rat Mouse Monoclonal antibody-Mouse; frozen, IH/flow/IA 500ul Ask price € accurate-monoclonals mouse
ACL8918A CD62L, L-Selectin, LECAM-1, Ly 22, Clone: MEL-14, Rat Mouse Monoclonal antibody-Mouse 500ul 439 € accurate-monoclonals mouse
ACL8918AP CD62L, L-Selectin, LECAM-1, Ly 22, Clone: MEL-14, Rat Mouse Monoclonal antibody-Mouse 0.25mg 254 € accurate-monoclonals mouse
ACL8918NA CD62L, L-Selectin, LECAM-1, Ly 22, Clone: MEL-14, Rat Mouse Monoclonal antibody-Mouse, azide-free 1 mg 582 € accurate-monoclonals mouse
YSRTMCA1259XZ CD62L, L-Selectin, LECAM-1, Ly 22, Clone: MEL-14, Rat Mouse Monoclonal antibody-Mouse, azide-free; flow/IP/functional assays 1 mg 1087 € accurate-monoclonals mouse
YSRTMCA1259Z CD62L, L-Selectin, LECAM-1, Ly 22, Clone: MEL-14, Rat Mouse Monoclonal antibody-Mouse, azide-free; flow/IP/functional assays 0.5 mg Ask price € accurate-monoclonals mouse
ACL8918B CD62L, L-Selectin, LECAM-1, Ly 22, Clone: MEL-14, Rat Mouse Monoclonal antibody-Mouse, Biotin 0.1mg 168 € accurate-monoclonals mouse
ACL8918B-3 CD62L, L-Selectin, LECAM-1, Ly 22, Clone: MEL-14, Rat Mouse Monoclonal antibody-Mouse, Biotin 0.3mg 340 € accurate-monoclonals mouse
ACL8918F CD62L, L-Selectin, LECAM-1, Ly 22, Clone: MEL-14, Rat Mouse Monoclonal antibody-Mouse, FITC 0.1mg 184 € accurate-monoclonals mouse
ACL8918F-3 CD62L, L-Selectin, LECAM-1, Ly 22, Clone: MEL-14, Rat Mouse Monoclonal antibody-Mouse, FITC 0.3mg 340 € accurate-monoclonals mouse
YSRTMCA1259 CD62L, L-Selectin, LECAM-1, Ly 22, Clone: MEL-14, Rat Mouse Monoclonal antibody-Mouse; frozen, IH/flow/IP 500ul Ask price € accurate-monoclonals mouse
YSRTMCA1259G CD62L, L-Selectin, LECAM-1, Ly 22, Clone: MEL-14, Rat Mouse Monoclonal antibody-Mouse; frozen, IH/flow/IP 0.25 mg 391 € accurate-monoclonals mouse
ACL8918PE CD62L, L-Selectin, LECAM-1, Ly 22, Clone: MEL-14, Rat Mouse Monoclonal antibody-Mouse, PE 50 ug 162 € accurate-monoclonals mouse
ACL8918PE-3 CD62L, L-Selectin, LECAM-1, Ly 22, Clone: MEL-14, Rat Mouse Monoclonal antibody-Mouse, PE 0.3mg 448 € accurate-monoclonals mouse
YSRTMCA1259PE CD62L, L-Selectin, LECAM-1, Ly 22, Clone: MEL-14, Rat Mouse Monoclonal antibody-Mouse, RPE vial 233 € accurate-monoclonals mouse
RP-1151RC Recombinant Cynomolgus CD62L / L-Selectin / SELL Protein (His Tag) 100μg 624 € adv human
RP-0353H Recombinant Human CD62L / L-Selectin / SELL Protein (His Tag) 100μg 624 € adv human
RP-1495M Recombinant Mouse SELP / selectin P / P-selectin Protein (His Tag) 50μg 456 € adv mouse
MEDCLA957-01 CD62L, L-Selectin, Clone: 9H6, Mouse Monoclonal antibody-Human; paraffin/NO frozen, IH/No WB 0.1000ul 428 € accurate-monoclonals human
MEDCLA957-1 CD62L, L-Selectin, Clone: 9H6, Mouse Monoclonal antibody-Human; paraffin/NO frozen, IH/No WB 1000ul 1097 € accurate-monoclonals human
YV0304-01 CD62L (L Selectin), Clone: DU1-29, Mouse Monoclonal antibody-Bovine,Goat,Sheep 0.1 mg 354 € accurate-monoclonals sheep
YV0304-05 CD62L (L Selectin), Clone: DU1-29, Mouse Monoclonal antibody-Bovine,Goat,Sheep 0.5 mg Ask price € accurate-monoclonals sheep
AXL7208F CD62L, L-Selectin, Clone: FMC46, Mouse Monoclonal antibody-Human, FITC; flow 1000ul Ask price € accurate-monoclonals human
MEDCLA269 CD62L, L-Selectin, Clone: FMC46, Mouse Monoclonal antibody-Human; frozen 1000ul 677 € accurate-monoclonals human
ACL085B CD62L, L-Selectin, Clone: OX-85, Mouse Monoclonal antibody-Rat, Biotin; flow/ELISA 0.1mg 211 € accurate-monoclonals rat
ACL085B-5 CD62L, L-Selectin, Clone: OX-85, Mouse Monoclonal antibody-Rat, Biotin; flow/ELISA 0.5mg 413 € accurate-monoclonals rat