| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human L-selectin /sell is produced by our Mammalian expression system and the target gene encoding Trp39-Asn332 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
34 kD |
| UniProt number: |
P14151 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 mM CaCl2, 2 mM MgCl2, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD62L (C-6His), L-Selectin |
| Short name: |
CD62L (C-6His), Recombinant L-Selectin |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD62L (C-6His), sapiens L-Selectin, recombinant H |
| Alternative technique: |
rec |
| Identity: |
10720 |
| Gene: |
SELL |
More about : SELL |
| Long gene name: |
selectin L |
| Synonyms gene: |
LYAM1 LNHR |
| Synonyms gene name: |
lymphocyte adhesion molecule 1 |
| Synonyms: |
LSEL LAM1 LAM-1 hLHRc Leu-8 Lyam-1 PLNHR CD62L |
| Locus: |
1q24, 2 |
| Discovery year: |
1989-06-07 |
| GenBank acession: |
M25280 |
| Entrez gene record: |
6402 |
| Pubmed identfication: |
2664786 1375831 |
| RefSeq identity: |
NM_000655 |
| Classification: |
Sushi domain containing Selectins CD molecules C-type lectin domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000034809 |