Recombinant Mouse Sonic Hedgehog, SHH

Contact us
Catalog number: CH69
Price: 485 €
Supplier: acr
Product name: Recombinant Mouse Sonic Hedgehog, SHH
Quantity: 50 Вµg
Other quantities: 1 mg 2283€ 10 µg 156€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Sonic Hedgehog is produced by our E, coli expression system and the target gene encoding Cys25-Gly198 is expressed
Molecular Weight: 19, 8 kD
UniProt number: Q62226
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 1 mM DTT, 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MCGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: SHH, Sonic Hedgehog
Short name: SHH, Recombinant Mouse Sonic Hedgehog
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: sonic hedgehog, recombinant Mouse Sonic Hedgehog
Alternative technique: rec
Alternative to gene target: DNA-templated and biological process this GO :0006508 and proteolysis and biological process this GO :0006897 and endocytosis and biological process this GO :0006915 and apoptotic process and biological process this GO :0007154 and cell communication and biological process this GO :0007224 and smoothened signaling pathway and biological process this GO :0007228 and positive regulation of hh target transcription factor activity and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0007368 and determination of left/right symmetry and biological process this GO :0007389 and pattern specification process and biological process this GO :0007398 and ectoderm development and biological process this GO :0007405 and neuroblast proliferation and biological process this GO :0007411 and axon guidance and biological process this GO :0007417 and central nervous system development and biological process this GO :0007418 and ventral midline development and biological process this GO :0007442 and hindgut morphogenesis and biological process this GO :0007507 and heart development and biological process this GO :0007596 and blood coagulation and biological process this GO :0008209 and androgen metabolic process and biological process this GO :0008233 and peptidase activity and molecular function this GO :0008270 and zinc ion binding and molecular function this GO :0008283 and cell proliferation and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0009790 and embryo development and biological process this GO :0009880 and embryonic pattern specification and biological process this GO :0009949 and polarity specification of anterior/posterior axis and biological process this GO :0009952 and anterior/posterior pattern specification and biological process this GO :0009953 and dorsal/ventral pattern formation and biological process this GO :0009986 and cell surface and cellular component this GO :0010463 and mesenchymal cell proliferation and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0010629 and negative regulation of gene expression and biological process this GO :0014003 and oli this GO dendrocyte development and biological process this GO :0014706 and striated muscle tissue development and biological process this GO :0014858 and positive regulation of skeletal muscle cell proliferation and biological process this GO :0014902 and myotube differentiation and biological process this GO :0016015 and morphogen activity and molecular function this GO :0016020 and membrane and cellular component this GO :0016539 and intein-mediated protein splicing and biological process this GO :0021513 and spinal cord dorsal/ventral patterning and biological process this GO :0021522 and spinal cord motor neuron differentiation and biological process this GO :0021794 and thalamus development and biological process this GO :0021904 and dorsal/ventral neural tube patterning and biological process this GO :0021930 and cerebellar granule cell precursor proliferation and biological process this GO :0021938 and smoothened signaling pathway involved in regulation of cerebellar granule cell precursor cell proliferation and biological process this GO :0021940 and positive regulation of cerebellar granule cell precursor proliferation and biological process this GO :0021978 and telencephalon regionalization and biological process this GO :0030010 and establishment of cell polarity and biological process this GO :0030162 and regulation of proteolysis and biological process this GO :0030177 and positive regulation of Wnt signaling pathway and biological process this GO :0030178 and negative regulation of Wnt signaling pathway and biological process this GO :0030323 and respiratory tube development and biological process this GO :0030324 and lung development and biological process this GO :0030326 and embryonic limb morphogenesis and biological process this GO :0030336 and negative regulation of cell migration and biological process this GO :0030539 and male genitalia development and biological process this GO :0030850 and prostate gland development and biological process this GO :0030878 and thyroid gland development and biological process this GO :0030900 and forebrain development and biological process this GO :0030901 and midbrain development and biological process this GO :0030902 and hindbrain development and biological process this GO :0031012 and extracellular matrix and cellular component this GO :0031016 and pancreas development and biological process this GO :0031069 and hair follicle morphogenesis and biological process this GO :0032435 and negative regulation of proteasomal ubiquitin-dependent protein catabolic process and biological process this GO :0033077 and T cell differentiation in thymus and biological process this GO :0033089 and positive regulation of T cell differentiation in thymus and biological process this GO :0033092 and positive regulation of immature T cell proliferation in thymus and biological process this GO :0034244 and negative regulation of transcription elongation from RNA polymerase II promoter and biological process this GO :0034504 and protein localization to nucleus and biological process this GO :0035115 and embryonic forelimb morphogenesis and biological process this GO :0035116 and embryonic hindlimb morphogenesis and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0042130 and negative regulation of T cell proliferation and biological process this GO :0042177 and negative regulation of protein catabolic process and biological process this GO :0042307 and positive regulation of protein import into nucleus and biological process this GO :0042475 and odontogenesis of dentin-containing tooth and biological process this GO :0042476 and odontogenesis and biological process this GO :0042481 and regulation of odontogenesis and biological process this GO :0042733 and embryonic digit morphogenesis and biological process this GO :0043010 and camera-type eye development and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043237 and laminin-1 binding and molecular function this GO :0043369 and CD4-positive or CD8-positive, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046638 and positive regulation of alpha-beta T cell differentiation and biological process this GO :0046639 and negative regulation of alpha-beta T cell differentiation and biological process this GO :0048468 and cell development and biological process this GO :0048538 and thymus development and biological process this GO :0048546 and digestive tract morphogenesis and biological process this GO :0048557 and embryonic digestive tract morphogenesis and biological process this GO :0048568 and embryonic organ development and biological process this GO :0048589 and developmental growth and biological process this GO :0048598 and embryonic morphogenesis and biological process this GO :0048617 and embryonic foregut morphogenesis and biological process this GO :0048643 and positive regulation of skeletal muscle tissue development and biological process this GO :0048645 and organ formation and biological process this GO :0048646 and anatomical structure formation involved in morphogenesis and biological process this GO :0048663 and neuron fate commitment and biological process this GO :0048706 and embryonic skeletal system development and biological process this GO :0048709 and oli this GO dendrocyte differentiation and biological process this GO :0048714 and positive regulation of oli this GO dendrocyte differentiation and biological process this GO :0048754 and branching morphogenesis of an epithelial tube and biological process this GO :0048839 and inner ear development and biological process this GO :0048856 and anatomical structure development and biological process this GO :0048859 and formation of anatomical boundary and biological process this GO :0048864 and stem cell development and biological process this GO :0051146 and striated muscle cell differentiation and biological process this GO :0051155 and positive regulation of striated muscle cell differentiation and biological process this GO :0051781 and positive regulation of cell division and biological process this GO :0060020 and Bergmann glial cell differentiation and biological process this GO :0060021 and palate development and biological process this GO :0060070 and canonical Wnt signaling pathway and biological process this GO :0060173 and limb development and biological process this GO :0060174 and limb bud formation and biological process this GO :0060425 and lung morphogenesis and biological process this GO :0060428 and lung epithelium development and biological process this GO :0060438 and trachea development and biological process this GO :0060439 and trachea morphogenesis and biological process this GO :0060441 and epithelial tube branching involved in lung morphogenesis and biological process this GO :0060442 and branching involved in prostate gland morphogenesis and biological process this GO :0060445 and branching involved in salivary gland morphogenesis and biological process this GO :0060447 and bud outgrowth involved in lung branching and biological process this GO :0060458 and right lung development and biological process this GO :0060459 and left lung development and biological process this GO :0060463 and lung lobe morphogenesis and biological process this GO :0060484 and lung-associated mesenchyme development and biological process this GO :0060516 and primary prostatic bud elongation and biological process this GO :0060523 and prostate epithelial cord elongation and biological process this GO :0060662 and salivary gland cavitation and biological process this GO :0060664 and epithelial cell proliferation involved in salivary gland morphogenesis and biological process this GO :0060684 and epithelial-mesenchymal cell signaling and biological process this GO :0060685 and regulation of prostatic bud formation and biological process this GO :0060738 and epithelial-mesenchymal signaling involved in prostate gland development and biological process this GO :0060768 and regulation of epithelial cell proliferation involved in prostate gland development and biological process this GO :0060769 and positive regulation of epithelial cell proliferation involved in prostate gland development and biological process this GO :0060782 and regulation of mesenchymal cell proliferation involved in prostate gland development and biological process this GO :0060783 and mesenchymal smoothened signaling pathway involved in prostate gland development and biological process this GO :0060840 and artery development and biological process this GO :0060916 and mesenchymal cell proliferation involved in lung development and biological process this GO :0061053 and somite development and biological process this GO :0061189 and positive regulation of sclerotome development and biological process this GO :0071285 and cellular response to lithium ion and biological process this GO :0072001 and renal system development and biological process this GO :0072136 and metanephric mesenchymal cell proliferation involved in metanephros development and biological process this GO :0080125 and multicellular structure septum development and biological process this GO :0090090 and negative regulation of canonical Wnt signaling pathway and biological process this GO :0090370 and negative regulation of cholesterol efflux and biological process this GO :0097190 and apoptotic signaling pathway and biological process this GO :1900175 and regulation of nodal signaling pathway involved in determination of lateral mesoderm left/right asymmetry and biological process this GO :1900180 and regulation of protein localization to nucleus and biological process this GO :2000062 and negative regulation of ureter smooth muscle cell differentiation and biological process this GO :2000063 and positive regulation of ureter smooth muscle cell differentiation and biological process this GO :2000357 and negative regulation of kidney smooth muscle cell differentiation and biological process this GO :2000358 and positive regulation of kidney smooth muscle cell differentiation and biological process this GO :2000729 and positive regulation of mesenchymal cell proliferation involved in ureter development and biological process this GO :2001054 and negative regulation of mesenchymal cell apoptotic process and biological process, HHG1 and HLP3 and HPE3 and MCOPCB5 and SMMCI and TPT and TPTPS, SHH and IDBG-50464 and ENSG00000164690 and 6469, SHH and IDBG-638249 and ENSBTAG00000024552 and, Shh and IDBG-144309 and ENSMUSG00000002633 and 20423, alpha-beta T cell lineage commitment and biological process this GO :0043588 and skin development and biological process this GO :0045059 and positive thymic T cell selection and biological process this GO :0045060 and negative thymic T cell selection and biological process this GO :0045109 and intermediate filament organization and biological process this GO :0045121 and membrane raft and cellular component this GO :0045165 and cell fate commitment and biological process this GO :0045445 and myoblast differentiation and biological process this GO :0045596 and negative regulation of cell differentiation and biological process this GO :0045597 and positive regulation of cell differentiation and biological process this GO :0045880 and positive regulation of smoothened signaling pathway and biological process this GO :0045893 and positive regulation of transcription, laminin-1 binding, nuclei, this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0001525 and angiogenesis and biological process this GO :0001569 and patterning of blood vessels and biological process this GO :0001570 and vasculogenesis and biological process this GO :0001656 and metanephros development and biological process this GO :0001658 and branching involved in ureteric bud morphogenesis and biological process this GO :0001708 and cell fate specification and biological process this GO :0001755 and neural crest cell migration and biological process this GO :0001822 and kidney development and biological process this GO :0001942 and hair follicle development and biological process this GO :0001944 and vasculature development and biological process this GO :0001947 and heart looping and biological process this GO :0001948 and glycoprotein binding and molecular function this GO :0002052 and positive regulation of neuroblast proliferation and biological process this GO :0002053 and positive regulation of mesenchymal cell proliferation and biological process this GO :0002076 and osteoblast development and biological process this GO :0002320 and lymphoid progenitor cell differentiation and biological process this GO :0003140 and determination of left/right asymmetry in lateral mesoderm and biological process this GO :0005113 and patched binding and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005539 and glycosaminoglycan binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006355 and regulation of transcription, this GO :0001948 : glycoprotein binding, this GO :0001948 : glycoprotein binding and also this GO :0005113 : patched binding and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0005539 : glycosaminoglycan binding and also this GO :0008233 : peptidase activity and also this GO :0008270 : zinc ion binding and also this GO :0016015 : morphogen activity and also this GO :0043237 : laminin-1 binding, this GO :0005113 : patched binding, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0005539 : glycosaminoglycan binding, this GO :0008233 : peptidase activity, this GO :0008270 : zinc ion binding, this GO :0016015 : morphogen activity, this GO :0043237 : laminin-1 binding, sonic hedgehog
Identity: 10848
Gene: SHH | More about : SHH
Long gene name: sonic hedgehog
Synonyms gene: HPE3 HLP3
Synonyms gene name: sonic hedgehog (Drosophila) homolog sonic hedgehog homolog (Drosophila)
Synonyms: HHG1 SMMCI TPT TPTPS MCOPCB5
Locus: 7q36, 3
Discovery year: 1995-03-10
Entrez gene record: 6469
Pubmed identfication: 7590746
RefSeq identity: NM_000193
Havana BLAST/BLAT: OTTHUMG00000151349

Related Products :

RP-1515M Recombinant Mouse SHH / Sonic hedgehog Protein (His Tag) 20μg 456 € adv mouse
CH69 Recombinant Mouse Sonic Hedgehog, SHH 50 µg 369 € novo mouse
CH66 Recombinant Mouse Sonic Hedgehog, SHH (C25II) 500 µg 1613 € novo mouse
RP-1410H Recombinant Human SHH / Sonic hedgehog Protein (aa 1-197, His Tag) 20μg 456 € adv human
RP-1411H Recombinant Human SHH / Sonic hedgehog Protein (aa 198-462, His Tag) 20μg 456 € adv human
C100 Recombinant Human Sonic Hedgehog, SHH 500 µg 1298 € novo human
GWB-BIG11A Recombinant Human Sonic Hedgehog (Shh) bulk Ask price € genways bulk human
C089 Recombinant Human Sonic Hedgehog, SHH C24II 1 mg 2283 € novo human
GWB-BIG1A8 Recombinant Murine Sonic Hedgehog (Shh) bulk Ask price € genways bulk human
103-M269 Anti-Mouse Sonic Hedgehog (Shh) C-terminal 100ug 336 € Reliatech antibodies mouse
AE19608MO-48 ELISA test for Mouse Sonic hedgehog N-Terminus (SHH-N) 1x plate of 48 wells 402 € abebio mouse
AE19609MO-48 ELISA test for Mouse Sonic hedgehog protein (SHH) 1x plate of 48 wells 373 € abebio mouse
GENTAUR-58bde8792c513 Mouse Monoclonal [clone 8G3] (IgG1) to Human Sonic Hedgehog / SHH Antibody 0.05 ml 597 € MBS mono human
AE19608MO Mouse Sonic hedgehog N-Terminus (SHH-N) ELISA Kit 96 wells plate 810 € ab-elisa elisas mouse
AE19608MO-96 Mouse Sonic hedgehog N-Terminus (SHH-N) ELISA Kit 1x plate of 96 wells 671 € abebio mouse
AE19609MO Mouse Sonic hedgehog protein (SHH) ELISA Kit 96 wells plate 769 € ab-elisa elisas mouse
AE19609MO-96 Mouse Sonic hedgehog protein (SHH) ELISA Kit 1x plate of 96 wells 612 € abebio mouse
GENTAUR-58bdc34329ea6 Anti- Hedgehog Homolog, Sonic (SHH) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdc3b0c5d12 Anti- Hedgehog Homolog, Sonic (SHH) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdc3f103c38 Anti- Hedgehog Homolog, Sonic (SHH) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdc3f161b31 Anti- Hedgehog Homolog, Sonic (SHH) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdce796136b Anti- Hedgehog Homolog, Sonic (SHH) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdce79bd858 Anti- Hedgehog Homolog, Sonic (SHH) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdd5c13d528 Anti- Hedgehog Homolog, Sonic (SHH) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58bddcbc30658 Anti- Hedgehog Homolog, Sonic (SHH) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bddd7f6210e Anti- Hedgehog Homolog, Sonic (SHH) Antibody 100ug 569 € MBS Polyclonals human
abx576316 Anti-Human Hedgehog Homolog, Sonic (SHH) ELISA Kit inquire 50 € abbex human
abx570960 Anti-Rat Hedgehog Homolog, Sonic (SHH) ELISA Kit inquire 50 € abbex rat
AR51857PU-N anti-Sonic hedgehog (SHH) (24-197, ) Antibody 0,25 mg 1109 € acr human
AR51857PU-S anti-Sonic hedgehog (SHH) (24-197, ) Antibody 50 Вµg 485 € acr human