| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Sonic Hedgehog is produced by our E, coli expression system and the target gene encoding Cys25-Gly198 is expressed |
| Molecular Weight: |
19, 8 kD |
| UniProt number: |
Q62226 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
1 mM DTT, 150 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MCGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
SHH, Sonic Hedgehog |
| Short name: |
SHH, Recombinant Mouse Sonic Hedgehog |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
sonic hedgehog, recombinant Mouse Sonic Hedgehog |
| Alternative technique: |
rec |
| Alternative to gene target: |
DNA-templated and biological process this GO :0006508 and proteolysis and biological process this GO :0006897 and endocytosis and biological process this GO :0006915 and apoptotic process and biological process this GO :0007154 and cell communication and biological process this GO :0007224 and smoothened signaling pathway and biological process this GO :0007228 and positive regulation of hh target transcription factor activity and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0007368 and determination of left/right symmetry and biological process this GO :0007389 and pattern specification process and biological process this GO :0007398 and ectoderm development and biological process this GO :0007405 and neuroblast proliferation and biological process this GO :0007411 and axon guidance and biological process this GO :0007417 and central nervous system development and biological process this GO :0007418 and ventral midline development and biological process this GO :0007442 and hindgut morphogenesis and biological process this GO :0007507 and heart development and biological process this GO :0007596 and blood coagulation and biological process this GO :0008209 and androgen metabolic process and biological process this GO :0008233 and peptidase activity and molecular function this GO :0008270 and zinc ion binding and molecular function this GO :0008283 and cell proliferation and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0009790 and embryo development and biological process this GO :0009880 and embryonic pattern specification and biological process this GO :0009949 and polarity specification of anterior/posterior axis and biological process this GO :0009952 and anterior/posterior pattern specification and biological process this GO :0009953 and dorsal/ventral pattern formation and biological process this GO :0009986 and cell surface and cellular component this GO :0010463 and mesenchymal cell proliferation and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0010629 and negative regulation of gene expression and biological process this GO :0014003 and oli this GO dendrocyte development and biological process this GO :0014706 and striated muscle tissue development and biological process this GO :0014858 and positive regulation of skeletal muscle cell proliferation and biological process this GO :0014902 and myotube differentiation and biological process this GO :0016015 and morphogen activity and molecular function this GO :0016020 and membrane and cellular component this GO :0016539 and intein-mediated protein splicing and biological process this GO :0021513 and spinal cord dorsal/ventral patterning and biological process this GO :0021522 and spinal cord motor neuron differentiation and biological process this GO :0021794 and thalamus development and biological process this GO :0021904 and dorsal/ventral neural tube patterning and biological process this GO :0021930 and cerebellar granule cell precursor proliferation and biological process this GO :0021938 and smoothened signaling pathway involved in regulation of cerebellar granule cell precursor cell proliferation and biological process this GO :0021940 and positive regulation of cerebellar granule cell precursor proliferation and biological process this GO :0021978 and telencephalon regionalization and biological process this GO :0030010 and establishment of cell polarity and biological process this GO :0030162 and regulation of proteolysis and biological process this GO :0030177 and positive regulation of Wnt signaling pathway and biological process this GO :0030178 and negative regulation of Wnt signaling pathway and biological process this GO :0030323 and respiratory tube development and biological process this GO :0030324 and lung development and biological process this GO :0030326 and embryonic limb morphogenesis and biological process this GO :0030336 and negative regulation of cell migration and biological process this GO :0030539 and male genitalia development and biological process this GO :0030850 and prostate gland development and biological process this GO :0030878 and thyroid gland development and biological process this GO :0030900 and forebrain development and biological process this GO :0030901 and midbrain development and biological process this GO :0030902 and hindbrain development and biological process this GO :0031012 and extracellular matrix and cellular component this GO :0031016 and pancreas development and biological process this GO :0031069 and hair follicle morphogenesis and biological process this GO :0032435 and negative regulation of proteasomal ubiquitin-dependent protein catabolic process and biological process this GO :0033077 and T cell differentiation in thymus and biological process this GO :0033089 and positive regulation of T cell differentiation in thymus and biological process this GO :0033092 and positive regulation of immature T cell proliferation in thymus and biological process this GO :0034244 and negative regulation of transcription elongation from RNA polymerase II promoter and biological process this GO :0034504 and protein localization to nucleus and biological process this GO :0035115 and embryonic forelimb morphogenesis and biological process this GO :0035116 and embryonic hindlimb morphogenesis and biological process this GO :0042127 and regulation of cell proliferation and biological process this GO :0042130 and negative regulation of T cell proliferation and biological process this GO :0042177 and negative regulation of protein catabolic process and biological process this GO :0042307 and positive regulation of protein import into nucleus and biological process this GO :0042475 and odontogenesis of dentin-containing tooth and biological process this GO :0042476 and odontogenesis and biological process this GO :0042481 and regulation of odontogenesis and biological process this GO :0042733 and embryonic digit morphogenesis and biological process this GO :0043010 and camera-type eye development and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043237 and laminin-1 binding and molecular function this GO :0043369 and CD4-positive or CD8-positive, DNA-templated and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046638 and positive regulation of alpha-beta T cell differentiation and biological process this GO :0046639 and negative regulation of alpha-beta T cell differentiation and biological process this GO :0048468 and cell development and biological process this GO :0048538 and thymus development and biological process this GO :0048546 and digestive tract morphogenesis and biological process this GO :0048557 and embryonic digestive tract morphogenesis and biological process this GO :0048568 and embryonic organ development and biological process this GO :0048589 and developmental growth and biological process this GO :0048598 and embryonic morphogenesis and biological process this GO :0048617 and embryonic foregut morphogenesis and biological process this GO :0048643 and positive regulation of skeletal muscle tissue development and biological process this GO :0048645 and organ formation and biological process this GO :0048646 and anatomical structure formation involved in morphogenesis and biological process this GO :0048663 and neuron fate commitment and biological process this GO :0048706 and embryonic skeletal system development and biological process this GO :0048709 and oli this GO dendrocyte differentiation and biological process this GO :0048714 and positive regulation of oli this GO dendrocyte differentiation and biological process this GO :0048754 and branching morphogenesis of an epithelial tube and biological process this GO :0048839 and inner ear development and biological process this GO :0048856 and anatomical structure development and biological process this GO :0048859 and formation of anatomical boundary and biological process this GO :0048864 and stem cell development and biological process this GO :0051146 and striated muscle cell differentiation and biological process this GO :0051155 and positive regulation of striated muscle cell differentiation and biological process this GO :0051781 and positive regulation of cell division and biological process this GO :0060020 and Bergmann glial cell differentiation and biological process this GO :0060021 and palate development and biological process this GO :0060070 and canonical Wnt signaling pathway and biological process this GO :0060173 and limb development and biological process this GO :0060174 and limb bud formation and biological process this GO :0060425 and lung morphogenesis and biological process this GO :0060428 and lung epithelium development and biological process this GO :0060438 and trachea development and biological process this GO :0060439 and trachea morphogenesis and biological process this GO :0060441 and epithelial tube branching involved in lung morphogenesis and biological process this GO :0060442 and branching involved in prostate gland morphogenesis and biological process this GO :0060445 and branching involved in salivary gland morphogenesis and biological process this GO :0060447 and bud outgrowth involved in lung branching and biological process this GO :0060458 and right lung development and biological process this GO :0060459 and left lung development and biological process this GO :0060463 and lung lobe morphogenesis and biological process this GO :0060484 and lung-associated mesenchyme development and biological process this GO :0060516 and primary prostatic bud elongation and biological process this GO :0060523 and prostate epithelial cord elongation and biological process this GO :0060662 and salivary gland cavitation and biological process this GO :0060664 and epithelial cell proliferation involved in salivary gland morphogenesis and biological process this GO :0060684 and epithelial-mesenchymal cell signaling and biological process this GO :0060685 and regulation of prostatic bud formation and biological process this GO :0060738 and epithelial-mesenchymal signaling involved in prostate gland development and biological process this GO :0060768 and regulation of epithelial cell proliferation involved in prostate gland development and biological process this GO :0060769 and positive regulation of epithelial cell proliferation involved in prostate gland development and biological process this GO :0060782 and regulation of mesenchymal cell proliferation involved in prostate gland development and biological process this GO :0060783 and mesenchymal smoothened signaling pathway involved in prostate gland development and biological process this GO :0060840 and artery development and biological process this GO :0060916 and mesenchymal cell proliferation involved in lung development and biological process this GO :0061053 and somite development and biological process this GO :0061189 and positive regulation of sclerotome development and biological process this GO :0071285 and cellular response to lithium ion and biological process this GO :0072001 and renal system development and biological process this GO :0072136 and metanephric mesenchymal cell proliferation involved in metanephros development and biological process this GO :0080125 and multicellular structure septum development and biological process this GO :0090090 and negative regulation of canonical Wnt signaling pathway and biological process this GO :0090370 and negative regulation of cholesterol efflux and biological process this GO :0097190 and apoptotic signaling pathway and biological process this GO :1900175 and regulation of nodal signaling pathway involved in determination of lateral mesoderm left/right asymmetry and biological process this GO :1900180 and regulation of protein localization to nucleus and biological process this GO :2000062 and negative regulation of ureter smooth muscle cell differentiation and biological process this GO :2000063 and positive regulation of ureter smooth muscle cell differentiation and biological process this GO :2000357 and negative regulation of kidney smooth muscle cell differentiation and biological process this GO :2000358 and positive regulation of kidney smooth muscle cell differentiation and biological process this GO :2000729 and positive regulation of mesenchymal cell proliferation involved in ureter development and biological process this GO :2001054 and negative regulation of mesenchymal cell apoptotic process and biological process, HHG1 and HLP3 and HPE3 and MCOPCB5 and SMMCI and TPT and TPTPS, SHH and IDBG-50464 and ENSG00000164690 and 6469, SHH and IDBG-638249 and ENSBTAG00000024552 and, Shh and IDBG-144309 and ENSMUSG00000002633 and 20423, alpha-beta T cell lineage commitment and biological process this GO :0043588 and skin development and biological process this GO :0045059 and positive thymic T cell selection and biological process this GO :0045060 and negative thymic T cell selection and biological process this GO :0045109 and intermediate filament organization and biological process this GO :0045121 and membrane raft and cellular component this GO :0045165 and cell fate commitment and biological process this GO :0045445 and myoblast differentiation and biological process this GO :0045596 and negative regulation of cell differentiation and biological process this GO :0045597 and positive regulation of cell differentiation and biological process this GO :0045880 and positive regulation of smoothened signaling pathway and biological process this GO :0045893 and positive regulation of transcription, laminin-1 binding, nuclei, this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0001525 and angiogenesis and biological process this GO :0001569 and patterning of blood vessels and biological process this GO :0001570 and vasculogenesis and biological process this GO :0001656 and metanephros development and biological process this GO :0001658 and branching involved in ureteric bud morphogenesis and biological process this GO :0001708 and cell fate specification and biological process this GO :0001755 and neural crest cell migration and biological process this GO :0001822 and kidney development and biological process this GO :0001942 and hair follicle development and biological process this GO :0001944 and vasculature development and biological process this GO :0001947 and heart looping and biological process this GO :0001948 and glycoprotein binding and molecular function this GO :0002052 and positive regulation of neuroblast proliferation and biological process this GO :0002053 and positive regulation of mesenchymal cell proliferation and biological process this GO :0002076 and osteoblast development and biological process this GO :0002320 and lymphoid progenitor cell differentiation and biological process this GO :0003140 and determination of left/right asymmetry in lateral mesoderm and biological process this GO :0005113 and patched binding and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005539 and glycosaminoglycan binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006355 and regulation of transcription, this GO :0001948 : glycoprotein binding, this GO :0001948 : glycoprotein binding and also this GO :0005113 : patched binding and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0005539 : glycosaminoglycan binding and also this GO :0008233 : peptidase activity and also this GO :0008270 : zinc ion binding and also this GO :0016015 : morphogen activity and also this GO :0043237 : laminin-1 binding, this GO :0005113 : patched binding, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0005539 : glycosaminoglycan binding, this GO :0008233 : peptidase activity, this GO :0008270 : zinc ion binding, this GO :0016015 : morphogen activity, this GO :0043237 : laminin-1 binding, sonic hedgehog |
| Identity: |
10848 |
| Gene: |
SHH |
More about : SHH |
| Long gene name: |
sonic hedgehog |
| Synonyms gene: |
HPE3 HLP3 |
| Synonyms gene name: |
sonic hedgehog (Drosophila) homolog sonic hedgehog homolog (Drosophila) |
| Synonyms: |
HHG1 SMMCI TPT TPTPS MCOPCB5 |
| Locus: |
7q36, 3 |
| Discovery year: |
1995-03-10 |
| Entrez gene record: |
6469 |
| Pubmed identfication: |
7590746 |
| RefSeq identity: |
NM_000193 |
| Havana BLAST/BLAT: |
OTTHUMG00000151349 |