Recombinant Mouse Macrophage Migration Inhibitory Factor, MIF (C-6His)

Contact us
Catalog number: CH27
Price: 745 €
Supplier: Biomatik ELISA kits
Product name: Recombinant Mouse Macrophage Migration Inhibitory Factor, MIF (C-6His)
Quantity: 1 plate of 96 wells
Other quantities: 1 mg 2283€ 10 µg 156€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Macrophage migration inhibitory factor is produced by our E, coli expression system and the target gene encoding Pro2-Ala115 is expressed with a 6His tag at the C-terminus
Molecular Weight: 13, 5 kD
UniProt number: P34884
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFALEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: MIF (C-6His), Macrophage Migration Inhibitory Factor
Short name: MIF (C-6His), Recombinant Mouse Macrophage Migration Inhibitory Factor
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: macrophage migration inhibitory factor (glycosylation-inhibiting factor) (C-6His), recombinant Mouse Macrophage Migration Inhibitory Factor
Alternative technique: rec
Alternative to gene target: Extracellular, GIF and GLIF and MMIF, MIF and IDBG-401910 and ENSG00000240972 and 4282, MIF and IDBG-637094 and ENSBTAG00000007375 and 280858, Mif and IDBG-163956 and ENSMUSG00000033307 and 17319, phenylpyruvate tautomerase activity, signal transduction by p53 class mediator and biological process this GO :0030890 and positive regulation of B cell proliferation and biological process this GO :0031666 and positive regulation of lipopolysaccharide-mediated signaling pathway and biological process this GO :0032269 and negative regulation of cellular protein metabolic process and biological process this GO :0033033 and negative regulation of myeloid cell apoptotic process and biological process this GO :0033138 and positive regulation of peptidyl-serine phosphorylation and biological process this GO :0042056 and chemoattractant activity and molecular function this GO :0042127 and regulation of cell proliferation and biological process this GO :0042327 and positive regulation of phosphorylation and biological process this GO :0043030 and regulation of macrophage activation and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043406 and positive regulation of MAP kinase activity and biological process this GO :0043518 and negative regulation of DNA damage response, signal transduction by p53 class mediator and biological process this GO :0045087 and innate immune response and biological process this GO :0048146 and positive regulation of fibroblast proliferation and biological process this GO :0050178 and phenylpyruvate tautomerase activity and molecular function this GO :0050715 and positive regulation of cytokine secretion and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0050918 and positive chemotaxis and biological process this GO :0061078 and positive regulation of prostaglandin secretion involved in immune response and biological process this GO :0061081 and positive regulation of myeloid leukocyte cytokine production involved in immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070207 and protein homotrimerization and biological process this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0071157 and negative regulation of cell cycle arrest and biological process this GO :0090238 and positive regulation of arachidonic acid secretion and biological process this GO :0090344 and negative regulation of cell aging and biological process this GO :1902166 and negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator and biological process this GO :2000343 and positive regulation of chemokine (C-X-C motif) ligand 2 production and biological process, this GO :0001516 and prostaglandin biosynthetic process and biological process this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0002906 and negative regulation of mature B cell apoptotic process and biological process this GO :0004167 and dopachrome isomerase activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005126 and cytokine receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006954 and inflammatory response and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007569 and cell aging and biological process this GO :0008283 and cell proliferation and biological process this GO :0009986 and cell surface and cellular component this GO :0010629 and negative regulation of gene expression and biological process this GO :0010739 and positive regulation of protein kinase A signaling and biological process this GO :0019752 and carboxylic acid metabolic process and biological process this GO :0030330 and DNA damage response, this GO :0004167 : dopachrome isomerase activity, this GO :0004167 : dopachrome isomerase activity and also this GO :0005102 : receptor binding and also this GO :0005125 : cytokine activity and also this GO :0005126 : cytokine receptor binding and also this GO :0005515 : protein binding and also this GO :0042056 : chemoattractant activity and also this GO :0050178 : phenylpyruvate tautomerase activity, this GO :0005102 : receptor binding, this GO :0005125 : cytokine activity, this GO :0005126 : cytokine receptor binding, this GO :0005515 : protein binding, this GO :0042056 : chemoattractant activity, this GO :0050178 : phenylpyruvate tautomerase activity, macrophage migration inhibitory factor (glycosylation-inhibiting factor)
Identity: 7097
Gene: MIF | More about : MIF
Long gene name: macrophage migration inhibitory factor (glycosylation-inhibiting factor)
Synonyms gene: GLIF
Synonyms: GIF
Locus: 22q11, 23
Discovery year: 1993-10-15
GenBank acession: M25639
Entrez gene record: 4282
Pubmed identfication: 7558020 2552447
RefSeq identity: NM_002415
Havana BLAST/BLAT: OTTHUMG00000150773

Related Products :

CH27 Recombinant Mouse Macrophage Migration Inhibitory Factor, MIF (C-6His) 1 mg 2283 € novo mouse
CH33 Recombinant Human Macrophage Migration Inhibitory Factor, MIF 1 mg 2486 € novo human
AE33500MO-48 ELISA test for Mouse Macrophage Migration Inhibitory Factor (MIF) 1x plate of 48 wells 373 € abebio mouse
AE33500MO Mouse Macrophage Migration Inhibitory Factor (MIF) ELISA Kit 48 wells plate 480 € ab-elisa elisas mouse
AE33500MO-96 Mouse Macrophage Migration Inhibitory Factor (MIF) ELISA Kit 1x plate of 96 wells 612 € abebio mouse
DL-MIF-Mu Mouse Macrophage Migration Inhibitory Factor MIF ELISA Kit 96T 869 € DL elisas mouse
KT-21382 Mouse Macrophage Migration Inhibitory Factor (MIF) ELISA kit 96 well plate 1138 € Kamiya mouse
GENTAUR-58bdc17a28a38 Anti- Macrophage Migration Inhibitory Factor (MIF) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdc17a89290 Anti- Macrophage Migration Inhibitory Factor (MIF) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdc2306754f Anti- Macrophage Migration Inhibitory Factor (MIF) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdc230cbd25 Anti- Macrophage Migration Inhibitory Factor (MIF) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdcd8737aa7 Anti- Macrophage Migration Inhibitory Factor (MIF) Antibody 50ug 354 € MBS Polyclonals human
GENTAUR-58bdcd87b13b7 Anti- Macrophage Migration Inhibitory Factor (MIF) Antibody 100ug 453 € MBS Polyclonals human
GENTAUR-58bdd203035a0 Anti- Macrophage Migration Inhibitory Factor (MIF) Antibody 100ug 486 € MBS Polyclonals human
GENTAUR-58bdd29931300 Anti- Macrophage Migration Inhibitory Factor (MIF) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdd2f6eefcc Anti- Macrophage Migration Inhibitory Factor (MIF) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdd426e5c89 Anti- Macrophage Migration Inhibitory Factor (MIF) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bddc3088b54 Anti- Macrophage Migration Inhibitory Factor (MIF) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bddc4c152d0 Anti- Macrophage Migration Inhibitory Factor (MIF) Antibody 100ug 520 € MBS Polyclonals human
AE33503CH Chicken Macrophage migration inhibitory factor (MIF) ELISA Kit 96 wells plate 810 € ab-elisa elisas chicken
AE33503CH-96 Chicken Macrophage migration inhibitory factor (MIF) ELISA Kit 1x plate of 96 wells 671 € abebio chicken
E-EL-Ch0273 Chicken MIF (Macrophage Migration Inhibitory Factor) ELISA Kit 96T 568 € elabsciences chicken
AE33503CH-48 ELISA test for Chicken Macrophage migration inhibitory factor (MIF) 1x plate of 48 wells 402 € abebio chicken
AE62903MK-48 ELISA test for Monkey Macrophage Migration Inhibitory Factor (MIF) 1x plate of 48 wells 373 € abebio monkey
DL-MIF-Hu Human Macrophage Migration Inhibitory Factor MIF ELISA Kit 96T 846 € DL elisas human
GENTAUR-58b9baddb2af8 Macrophage migration inhibitory factor homolog (MIF) 100ug 1404 € MBS Recombinant Proteins human
GENTAUR-58b9bade0a787 Macrophage migration inhibitory factor homolog (MIF) 1000ug 1404 € MBS Recombinant Proteins human
GENTAUR-58b9bade67b33 Macrophage migration inhibitory factor homolog (MIF) 100ug 1906 € MBS Recombinant Proteins human
GENTAUR-58b9bade9bcac Macrophage migration inhibitory factor homolog (MIF) 1000ug 1906 € MBS Recombinant Proteins human
EKU05761 Macrophage Migration Inhibitory Factor (MIF) ELISA kit 1 plate of 96 wells 745 € Biomatik ELISA kits human