Recombinant Mouse Tumor Necrosis Factor Receptor I, TNFRSF1A, CD120a

Contact us
Catalog number: CG50
Price: 624 €
Supplier: adv
Product name: Recombinant Mouse Tumor Necrosis Factor Receptor I, TNFRSF1A, CD120a
Quantity: 50μg
Other quantities: 10 µg 146€ 50 µg 303€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Tumor Necrosis Factor Receptor I is produced by our E, coli expression system and the target gene encoding Ile22-Ala212 is expressed
Molecular Weight: 2 kD, 21
UniProt number: P25118
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of 20 mM PB,150 mM sodium chloride, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MIHPSGVTGLVPSLGDREKRDSLCPQGKYVHSKNNSICCTKCHKGTYLVSDCPSPGRDTVCRECEKGTFTASQNYLRQCLSCKTCRKEMSQVEISPCQADKDTVCGCKENQFQRYLSETHFQCVDCSPCFNGTVTIPCKETQNTVCNCHAGFFLRESECVPCSHCKKNEECMKLCLPPPLANVTNPQDSGTA
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CD120a, TNFRSF1A, Tumor Necrosis Factor Receptor I
Short name: CD120a, TNFRSF1A, Recombinant Mouse Tumor Necrosis Factor Receptor I
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: CD120a, member 1A, tumor necrosis factor receptor superfamily, recombinant Mouse Tumor Necrosis Factor Receptor I
Alternative technique: rec
Alternative to gene target: CD120a and FPF and MS5 and p55 and p55-R and p60 and TBP1 and TNF-R and TNF-R-I and TNF-R55 and TNFAR and TNFR1 and TNFR1-d2 and TNFR55 and TNFR60, TNFRSF1A and IDBG-13807 and ENSG00000067182 and 7132, TNFRSF1A and IDBG-640513 and ENSBTAG00000004211 and 282527, Tnfrsf1a and IDBG-189844 and ENSMUSG00000030341 and 21937, member 1A, nuclei, this GO :0000139 and this GO lgi membrane and cellular component this GO :0001666 and response to hypoxia and biological process this GO :0002020 and protease binding and molecular function this GO :0005031 and tumor necrosis factor-activated receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006693 and prostaglandin metabolic process and biological process this GO :0006915 and apoptotic process and biological process this GO :0006952 and defense response and biological process this GO :0006954 and inflammatory response and biological process this GO :0007165 and signal transduction and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0008625 and extrinsic apoptotic signaling pathway via death domain receptors and biological process this GO :0008630 and intrinsic apoptotic signaling pathway in response to DNA damage and biological process this GO :0009611 and response to wounding and biological process this GO :0009986 and cell surface and cellular component this GO :0010628 and positive regulation of gene expression and biological process this GO :0010629 and negative regulation of gene expression and biological process this GO :0016032 and viral process and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0030424 and axon and cellular component this GO :0032403 and protein complex binding and molecular function this GO :0032496 and response to lipopolysaccharide and biological process this GO :0032715 and negative regulation of interleukin-6 production and biological process this GO :0032760 and positive regulation of tumor necrosis factor production and biological process this GO :0033013 and tetrapyrrole metabolic process and biological process this GO :0033160 and positive regulation of protein import into nucleus, this GO :0002020 : protease binding, this GO :0002020 : protease binding and also this GO :0005031 : tumor necrosis factor-activated receptor activity and also this GO :0005515 : protein binding and also this GO :0032403 : protein complex binding and also this GO :0043120 : tumor necrosis factor binding, this GO :0005031 : tumor necrosis factor-activated receptor activity, this GO :0005515 : protein binding, this GO :0032403 : protein complex binding, this GO :0043120 : tumor necrosis factor binding, translocation and biological process this GO :0033209 and tumor necrosis factor-mediated signaling pathway and biological process this GO :0042511 and positive regulation of tyrosine phosphorylation of Stat1 protein and biological process this GO :0042742 and defense response to bacterium and biological process this GO :0042981 and regulation of apoptotic process and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043120 and tumor necrosis factor binding and molecular function this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043200 and response to amino acid and biological process this GO :0043234 and protein complex and cellular component this GO :0043235 and receptor complex and cellular component this GO :0043279 and response to alkaloid and biological process this GO :0043525 and positive regulation of neuron apoptotic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045121 and membrane raft and cellular component this GO :0045202 and synapse and cellular component this GO :0045471 and response to ethanol and biological process this GO :0045766 and positive regulation of angiogenesis and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0050728 and negative regulation of inflammatory response and biological process this GO :0050729 and positive regulation of inflammatory response and biological process this GO :0051291 and protein heterooli this GO merization and biological process this GO :0071260 and cellular response to mechanical stimulus and biological process this GO :0071392 and cellular response to estradiol stimulus and biological process this GO :0097190 and apoptotic signaling pathway and biological process, tumor necrosis factor binding, tumor necrosis factor receptor superfamily
Identity: 11916
Gene: TNFRSF1A | More about : TNFRSF1A
Long gene name: TNF receptor superfamily member 1A
Synonyms gene: TNFR1
Synonyms gene name: member 1A , tumor necrosis factor receptor superfamily
Synonyms: TNF-R TNFAR TNFR60 TNF-R-I CD120a TNF-R55
Locus: 12p13, 31
Discovery year: 1991-01-15
GenBank acession: M75866
Entrez gene record: 7132
Pubmed identfication: 1655358 2158863
RefSeq identity: NM_001065
Classification: CD molecules Tumor necrosis factor receptor superfamily
Havana BLAST/BLAT: OTTHUMG00000168267
Locus Specific Databases: INFEVERS: The repertory of Familial Mediterranean Fever (FMF) and Hereditary Inflammatory Disorders Mutations LRG_193

Related Products :

MBS617120 Tumor Necrosis Factor Receptor 1, p55/p60 (TNFR 1, CD120a, MGC19588, p55, p55 R, TNFR55, Tumor Necrosis Factor alpha Receptor, Tumor Necrosis Factor Binding Protein 1, TBP1, Tumor Necrosis Factor Receptor Superfamily Member 1A, TNFRSF1a) 100ug 868 € MBS Polyclonals_1 human
CG50 Recombinant Mouse Tumor Necrosis Factor Receptor I, TNFRSF1A, CD120a 1 mg 2283 € novo mouse
CP04 Recombinant Human Tumor Necrosis Factor Receptor I, TNFRSF1A, CD120a (C-Fc) 1 mg 2283 € novo human
C689 Recombinant Human Tumor Necrosis Factor Receptor I, TNFRSF1A, CD120a (N-6His) 10 µg 156 € novo human
MBS620184 TNF Receptor, Extracellular Domain p55 (TNFR 1, CD120a, MGC19588, p55, p55 R, TNFR55, Tumor Necrosis Factor alpha Receptor, Tumor Necrosis Factor Binding Protein 1, TBP1, Tumor Necrosis Factor Receptor Superfamily Member 1A, TNFRSF1a) Antibody 1000ug 685 € MBS Polyclonals_1 human
MBS619623 Tumor Necrosis Factor Receptor 1, p55/p60 (TNFR 1, TNFR1, TNF-R1, TNF-R, Tumor Necrosis Factor Receptor Type I, TNFR-I, TNF-RI, TNF-R-I, CD120a, FPF, MGC19588, p55, p55-R, p60, TBP1, TNFR55, TNF-R55, TNFR60, Tumor Necrosis Factor alpha Receptor, TNFAR, Tu Antibody 100ug 652 € MBS Polyclonals_1 human
MBS621645 DR6 (Death Receptor 6, BM018, MGC31965, TNFR Related Death Receptor 6, Tumor Necrosis Factor Receptor Superfamily Member 21, Tumor Necrosis Factor Receptor Superfamily Member 21 Precursor, TNFRSF21) Antibody 100ug 564 € MBS Polyclonals_1 human
MBS624468 Tumor Necrosis Factor Receptor 2, p75/p80 (TNFR 2, Tnfr2, Tnfr-2, TNF-R2, Tumor Necrosis Factor Receptor Type II, TNFRII, TNFR-II, TNF-RII, TNF-R-II, CD120b, p75, p80 TNF alpha Receptor, TNF-R75, TNFR80, TNFalpha-R2, TNF-alphaR2, Tumor Necrosis Factor bet 1 mililiter 1061 € MBS Polyclonals_1 human
RP-1556M Recombinant Mouse TNFR1 / CD120a / TNFRSF1A Protein (Fc Tag) 50μg 624 € adv mouse
RP-1557M Recombinant Mouse TNFR1 / CD120a / TNFRSF1A Protein (His Tag) 50μg 624 € adv mouse
GENTAUR-58bdc3dcb8697 Anti- Tumor Necrosis Factor Receptor Superfamily, Member 1A (TNFRSF1A) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdc474b6bb9 Anti- Tumor Necrosis Factor Receptor Superfamily, Member 1A (TNFRSF1A) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdc6203e3b7 Anti- Tumor Necrosis Factor Receptor Superfamily, Member 1A (TNFRSF1A) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdc620a05e6 Anti- Tumor Necrosis Factor Receptor Superfamily, Member 1A (TNFRSF1A) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdce6fc3981 Anti- Tumor Necrosis Factor Receptor Superfamily, Member 1A (TNFRSF1A) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdce7078d38 Anti- Tumor Necrosis Factor Receptor Superfamily, Member 1A (TNFRSF1A) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdcfc41da2d Anti- Tumor Necrosis Factor Receptor Superfamily, Member 1A (TNFRSF1A) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdcfc478c40 Anti- Tumor Necrosis Factor Receptor Superfamily, Member 1A (TNFRSF1A) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdd1da3f9c0 Anti- Tumor Necrosis Factor Receptor Superfamily, Member 1A (TNFRSF1A) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd7f5c1089 Anti- Tumor Necrosis Factor Receptor Superfamily, Member 1A (TNFRSF1A) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58bddaa5777f4 Anti- Tumor Necrosis Factor Receptor Superfamily, Member 1A (TNFRSF1A) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58bddc6ea65e5 Anti- Tumor Necrosis Factor Receptor Superfamily, Member 1A (TNFRSF1A) Antibody 100ug 553 € MBS Polyclonals human
DL-TNFRSF1A-Hu Human Tumor Necrosis Factor Receptor Superfamily, Member 1A TNFRSF1A ELISA Kit 96T 568 € DL elisas human
DL-TNFRSF1A-Ra Rat Tumor Necrosis Factor Receptor Superfamily, Member 1A TNFRSF1A ELISA Kit 96T 846 € DL elisas rat
MBS619939 Tumor Necrosis Factor Receptor 1-Associated Death Domain Protein Isoform 2 (TRADD, TNFR1-associated DEATH domain protein, TNFRSF1A-associated via death domain, Tumor necrosis factor receptor type 1-associated DEATH domain protein) Antibody 100ug 763 € MBS Polyclonals_1 human
EKU07973 Tumor Necrosis Factor Receptor Superfamily, Member 1A (TNFRSF1A) ELISA kit 1 plate of 96 wells 542 € Biomatik ELISA kits human
EKU07974 Tumor Necrosis Factor Receptor Superfamily, Member 1A (TNFRSF1A) ELISA kit 1 plate of 96 wells 846 € Biomatik ELISA kits human
EKU08400 Tumor Necrosis Factor Receptor Superfamily, Member 1A (TNFRSF1A) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
GWB-EE7C95 Tumor Necrosis Factor Receptor Superfamily, Member 1A (TNFRSF1A) Rabbit antibody to or anti-Human Polyclonal antibody 1 vial 602 € genways human
RP-1526H Recombinant Human TNFR1 / CD120a / TNFRSF1A Protein (His & Fc Tag) 50μg 624 € adv human