Recombinant Human Endothelial Differentiation-Related Factor 1, EDF1, MBF1 (C-6His)

Contact us
Catalog number: CE12
Price: 2000 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Endothelial Differentiation-Related Factor 1, EDF1, MBF1 (C-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 10 µg 202€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human EDF1 is produced by our E, coli expression system and the target gene encoding Ala2-Lys148 is expressed with a 6His tag at the C-terminus
Molecular Weight: 17, 4 kD
UniProt number: O60869
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM TrisHCl, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: AESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAKLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: EDF1, MBF1 (C-6His), Endothelial Differentiation-Related Factor 1
Short name: EDF1, MBF1 (C-6His), Recombinant Endothelial Differentiation- Factor 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: EDF1, MBF1 (C-6His), sapiens Endothelial Differentiation-Related Factor 1, recombinant H
Alternative technique: rec
Identity: 3164
Gene: EDF1 | More about : EDF1
Long gene name: endothelial differentiation related factor 1
Synonyms gene name: endothelial differentiation-related factor 1
Synonyms: EDF-1 CFAP280
Synonyms name: multiprotein bridging factor-1
Locus: 9q34, 3
Discovery year: 1999-01-07
GenBank acession: AJ005259
Entrez gene record: 8721
Pubmed identfication: 9813014 15112053
Havana BLAST/BLAT: OTTHUMG00000020948

Related Products :

CE12 Recombinant Human Endothelial Differentiation-Related Factor 1, EDF1, MBF1 (C-6His) 10 µg 202 € novo human
GENTAUR-58bb6690af2d2 Human Endothelial differentiation-related factor 1 (EDF1) 100ug 1487 € MBS Recombinant Proteins human
GENTAUR-58bb669107b2c Human Endothelial differentiation-related factor 1 (EDF1) 1000ug 1487 € MBS Recombinant Proteins human
GENTAUR-58bb6691b967b Human Endothelial differentiation-related factor 1 (EDF1) 100ug 1989 € MBS Recombinant Proteins human
GENTAUR-58bb66920f5e2 Human Endothelial differentiation-related factor 1 (EDF1) 1000ug 1989 € MBS Recombinant Proteins human
AE46194CH Chicken Endothelial differentiation-related factor 1 (EDF1) ELISA Kit 48 wells plate 500 € ab-elisa elisas chicken
AE46194CH-96 Chicken Endothelial differentiation-related factor 1 (EDF1) ELISA Kit 1x plate of 96 wells 671 € abebio chicken
GENTAUR-58bda5648d008 Chicken Endothelial differentiation-related factor 1 homolog (EDF1) 100ug 1492 € MBS Recombinant Proteins chicken
GENTAUR-58bda564d8f42 Chicken Endothelial differentiation-related factor 1 homolog (EDF1) 1000ug 1492 € MBS Recombinant Proteins chicken
GENTAUR-58bda5653e506 Chicken Endothelial differentiation-related factor 1 homolog (EDF1) 100ug 1995 € MBS Recombinant Proteins chicken
GENTAUR-58bda5657a7e2 Chicken Endothelial differentiation-related factor 1 homolog (EDF1) 1000ug 1995 € MBS Recombinant Proteins chicken
AE46194CH-48 ELISA test for Chicken Endothelial differentiation-related factor 1 (EDF1) 1x plate of 48 wells 402 € abebio chicken
GENTAUR-58bd930f1f417 Mouse Endothelial differentiation-related factor 1 (Edf1) 100ug 1487 € MBS Recombinant Proteins mouse
GENTAUR-58bd930f62df0 Mouse Endothelial differentiation-related factor 1 (Edf1) 1000ug 1487 € MBS Recombinant Proteins mouse
GENTAUR-58bd930fa85a6 Mouse Endothelial differentiation-related factor 1 (Edf1) 100ug 1989 € MBS Recombinant Proteins mouse
GENTAUR-58bd930fe486e Mouse Endothelial differentiation-related factor 1 (Edf1) 1000ug 1989 € MBS Recombinant Proteins mouse
MBS244629 Goat Polyclonal to Human EDF1 / MBF1 Antibody 50ug 597 € MBS Polyclonals_1 human
MBS621925 EDG1 (Endothelial Cell Differentiation Gene 1, EDG 1, EDG-1, Endothelial Differentiation Sphingolipid G Protein Coupled Receptor 1, CHEDG1, D1S3362, G Protein Coupled Sphingolipid Receptor, Sphingosine 1-phosphate Receptor Edg-1, Sphingosine 1-phosphate R Antibody 100ug 569 € MBS Polyclonals_1 human
abx261411 Anti-Endothelial Differentiation-Related Factor 1 Protein (Recombinant) 25 µg 340 € abbex human
MBS622250 Endothelial Monocyte Activating Polypeptide II (EMAP II, EMAPII, Endothelial Monocyte Activating Polypeptide 2, EMAP 2, EMAP2, AIMP1, Endothelial Monocyte Activating Polypeptide, Multisynthetase Complex Auxiliary Component p43, p43, Small Inducible Cytoki Antibody 100ug 630 € MBS Polyclonals_1 human
MBS621812 MyD88, CT, Blocking Peptide (Myeloid Differentiation Marker 88, Myeloid Differentiation Primary Response Gene, Myeloid Differentiation Primary Response Protein MyD88) Antibody 100ug 558 € MBS Polyclonals_1 human
MBS624600 NFE2L2, NT (NRF2, Nuclear Factor Erythroid 2-related Factor 2, NFE2-related Factor 2, NF-E2-related Factor 2, Nuclear Factor, Erythroid Derived 2, Like 2, HEBP1) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS623127 Leukemia Inhibitory Factor (LIF, Cholinergic Differentiation Factor, CDF, DIA, Differentiation-stimulating Factor, D Factor, HILDA, Melanoma-derived LPL Inhibitor, MLPLI) Antibody 100ug 564 € MBS Polyclonals_1 human
GENTAUR-58bb3d1f1e150 Cryptococcus neoformans var. neoformans serotype D Multiprotein-bridging factor 1 (MBF1) 100ug 1498 € MBS Recombinant Proteins human
GENTAUR-58bb3d1f6e22d Cryptococcus neoformans var. neoformans serotype D Multiprotein-bridging factor 1 (MBF1) 1000ug 1498 € MBS Recombinant Proteins human
GENTAUR-58bb3d1fb8e01 Cryptococcus neoformans var. neoformans serotype D Multiprotein-bridging factor 1 (MBF1) 100ug 2000 € MBS Recombinant Proteins human
GENTAUR-58bb3d1ff2f55 Cryptococcus neoformans var. neoformans serotype D Multiprotein-bridging factor 1 (MBF1) 1000ug 2000 € MBS Recombinant Proteins human
GENTAUR-58bd0d694afc8 Cryptococcus neoformans var. neoformans serotype D Multiprotein-bridging factor 1 (MBF1) 100ug 1498 € MBS Recombinant Proteins human
GENTAUR-58bd0d6999996 Cryptococcus neoformans var. neoformans serotype D Multiprotein-bridging factor 1 (MBF1) 1000ug 1498 € MBS Recombinant Proteins human
GENTAUR-58bd0d69e3d0c Cryptococcus neoformans var. neoformans serotype D Multiprotein-bridging factor 1 (MBF1) 100ug 2000 € MBS Recombinant Proteins human