Recombinant Mouse TWEAK Receptor, TWEAK R, TNFRSF12A (C-Fc)

Contact us
Catalog number: CD75
Price: 350 €
Supplier: Bioss Primary Conjugated Antibodies
Product name: Recombinant Mouse TWEAK Receptor, TWEAK R, TNFRSF12A (C-Fc)
Quantity: 0.1ml
Other quantities: 1 mg 2283€ 50 µg 303€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse TWEAK Receptor is produced by our Mammalian expression system and the target gene encoding Glu28-Trp79 is expressed with a Fc tag at the C-terminus
Molecular Weight: 32, 6 kD
UniProt number: Q9CR75
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: EQAPGTSPCSSGSSWSADLDKCMDCASCPARPHSDFCLGCAAAPPAHFRLLWVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: TNFRSF12A (C-Fc), TWEAK R, TWEAK Receptor
Short name: TNFRSF12A (C-Fc), TWEAK R, Recombinant Mouse TWEAK Receptor
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: TWEAK R, member 12A (C-fragment c), tumor necrosis factor receptor superfamily, recombinant Mouse TWEAK Receptor
Alternative technique: rec
Alternative to gene target: BT, Cell surfaces, TNFRSF12A and IDBG-11328 and ENSG00000006327 and 51330, Tnfrsf12a and IDBG-143687 and ENSMUSG00000023905 and 27279, cell attachment to substrate and biological process this GO :0007155 and cell adhesion and biological process this GO :0009986 and cell surface and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045765 and regulation of angiogenesis and biological process this GO :0045773 and positive regulation of axon extension and biological process this GO :0061041 and regulation of wound healing and biological process this GO :0097191 and extrinsic apoptotic signaling pathway and biological process this GO :2001238 and positive regulation of extrinsic apoptotic signaling pathway and biological process, member 12A, protein binding, this GO :0001525 and angiogenesis and biological process this GO :0001726 and ruffle and cellular component this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0006931 and substrate-dependent cell migration, this GO :0005515 : protein binding, this GO :0005515 : protein binding, 20111 and IDBG-635818 and ENSBTAG00000012082 and 617439, tumor necrosis factor receptor superfamily
Identity: 18152
Gene: TNFRSF12A | More about : TNFRSF12A
Long gene name: TNF receptor superfamily member 12A
Synonyms gene name: member 12A , tumor necrosis factor receptor superfamily
Synonyms: FN14 TweakR CD266
Locus: 16p13, 3
Discovery year: 2002-12-20
GenBank acession: AB035480
Pubmed identfication: 10751351 10551889
Classification: CD molecules Tumor necrosis factor receptor superfamily
Havana BLAST/BLAT: OTTHUMG00000129001

Related Products :

CD75 Recombinant Mouse TWEAK Receptor, TWEAK R, TNFRSF12A (C-Fc) 50 µg 303 € novo mouse
CD27 Recombinant Human TWEAK Receptor, TWEAK R, TNFRSF12A (C-Fc) 1 mg 2283 € novo human
MBS618212 Tweak Receptor (TWEAK R, TWEAKR, CD266, Fibroblast Growth Factor-inducible Immediate Early Response Protein 14, FGF-inducible 14, FN14, Tumor Necrosis Factor Receptor Superfamily Member 12A, TNFRSF12A, Type I Transmembrane Protein Fn14) 50ug 724 € MBS Polyclonals_1 human
RP-1530H Recombinant Human TNFRSF12A / FN14 / TWEAKR Protein (Fc Tag) 50μg 624 € adv human
EKU08323 Tumor Necrosis Factor Receptor Superfamily, Member 12A (TNFRSF12A) ELISA kit 1 plate of 96 wells 745 € Biomatik ELISA kits human
GWB-E8AB77 Tumor Necrosis Factor Receptor Superfamily, Member 12A (TNFRSF12A) Rabbit antibody to or anti-Human Polyclonal antibody 1 vial 602 € genways human
GWB-BIG13E Recombinant Human TWEAK Receptor bulk Ask price € genways bulk human
ZR-40-312 TWEAK Receptor Recombinant Protein 0.005 mg 256 € Zyagen human
MBS619539 Orexin 1 Receptor (Orexin Receptor 1, Orexin Receptor-1, Orexin Receptor Type 1, OX1R, Hypocretin 1 Receptor, Hypocretin Receptor 1, Hypocretin Receptor-1, Hypocretin Receptor Type 1, HCRTR1) 100ug 735 € MBS Polyclonals_1 human
MBS240311 Anti-Human TNFRSF12A / FN14 Antibody 50ug 597 € MBS Polyclonals_1 human
GENTAUR-58bdeefa1d289 Anti- TNFRSF12A Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdeefa6faac Anti- TNFRSF12A Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdfc7650a23 Anti- TNFRSF12A Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdfc76c4bf8 Anti- TNFRSF12A Antibody 0.06 ml 265 € MBS Polyclonals human
abx219029 Anti-TNFRSF12A Antibody 200 μg 369 € abbex human
GENTAUR-58be60b49eb83 Anti-TNFRSF12A (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
abx937591 Anti-TNFRSF12A siRNA inquire 50 € abbex human
abx937592 Anti-TNFRSF12A siRNA 30 nmol 717 € abbex human
GWB-MS218B Tnfrsf12a antibody 1 vial 521 € genways human
bs-2493R-A350 TNFRSF12A Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2493R-A488 TNFRSF12A Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2493R-A555 TNFRSF12A Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2493R-A594 TNFRSF12A Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2493R-A647 TNFRSF12A Antibody, ALEXA FLUOR 647 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-2493R-Biotin TNFRSF12A Antibody, Biotin Conjugated 0.1ml 333 € Bioss Primary Conjugated Antibodies human
bs-2493R TNFRSF12A Antibody 0.1ml 263 € Bioss Primary Unconjugated Antibodies human
bs-2493R-Cy3 TNFRSF12A Antibody, Cy3 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-2493R-Cy5 TNFRSF12A Antibody, Cy5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-2493R-Cy5.5 TNFRSF12A Antibody, Cy5.5 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human
bs-2493R-Cy7 TNFRSF12A Antibody, Cy7 Conjugated 0.1ml 350 € Bioss Primary Conjugated Antibodies human