Recombinant Mouse IL-17A

Contact us
Catalog number: CD14
Price: 1956 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Mouse IL-17A
Quantity: 100ug
Other quantities: 1 mg 2283€ 10 µg 156€ 5 µg 220€ 50 µg 369€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Interleukin-17A is produced by our Mammalian expression system and the target gene encoding Thr22-Ala158 is expressed with a 6His tag at the C-terminus
Molecular Weight: 16, 2 kD
UniProt number: Q62386
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEGTPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPEAEANEKQQDDRQQEAPGAGASTPAWVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: IL-17A
Short name: Recombinant Mouse IL-17A
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: recombinant Mouse Interleukin-17A
Alternative technique: rec
Identity: 5981
Gene: IL17A | More about : IL17A
Long gene name: interleukin 17A
Synonyms gene: CTLA8 IL17
Synonyms gene name: interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8)
Synonyms: IL-17A IL-17
Synonyms name: cytotoxic T-lymphocyte-associated protein 8
Locus: 6p12, 2
Discovery year: 1993-10-25
GenBank acession: U32659
Entrez gene record: 3605
Pubmed identfication: 8390535
RefSeq identity: NM_002190
Classification: Interleukins
Havana BLAST/BLAT: OTTHUMG00000014840

Related Products :

CI60 Recombinant Human Interleukin-17A, F Heterodimer, IL-17A & IL-17F (C-6His) 1 mg 2486 € novo human
C021 Recombinant Human Interleukin-17A, IL-17A 500 µg 1298 € novo human
C774 Recombinant Human Interleukin-17A, IL-17A (C-6His) 1 mg 2283 € novo human
MBS621852 17a-Hydroxyprogesterone-3-CMO (17-Hydroxy-pregn-4-ene-3,20-dione, 4-Pregnen-17a-ol-3,20-dione) Antibody 1 mililiter 531 € MBS Polyclonals_1 human
AE62989HU-48 ELISA test for Human Interleukin 17A (IL-17A/IL-17) 1x plate of 48 wells 373 € abebio human
AE62989HU Human Interleukin 17A (IL-17A/IL-17) ELISA Kit 96 wells plate 769 € ab-elisa elisas human
AE62989HU-96 Human Interleukin 17A (IL-17A/IL-17) ELISA Kit 1x plate of 96 wells 612 € abebio human
6485 Recombinant Mouse IL-17A 5 µg 220 € Immunochemistry kits mouse
CD14 Recombinant Mouse IL-17A 500 µg 1613 € novo mouse
ZR-40-263 IL-17A Recombinant Protein 0.005 mg 256 € Zyagen human
ZR-40-423 IL-17A Recombinant Protein 0.005 mg 256 € Zyagen human
ZR-40-521 IL-17A Recombinant Protein 0.025 mg 376 € Zyagen human
6388 Recombinant Bovine IL-17A 5 µg 220 € Immunochemistry kits bovine
6586 Recombinant Canine IL-17A 5 µg 220 € Immunochemistry kits human
6686 Recombinant Cynomolgus Monkey IL-17A 5 µg 220 € Immunochemistry kits monkey
6408 Recombinant Equine IL-17A 5 µg 220 € Immunochemistry kits human
6687 Recombinant Feline IL-17A 5 µg 220 € Immunochemistry kits human
GWB-BIG019 Recombinant Human IL-17 (IL-17A) bulk Ask price € genways bulk human
6587 Recombinant Human IL-17A 5 µg 220 € Immunochemistry kits human
GWB-784CF7 Recombinant Human Interleukin-17A His Tag bulk Ask price € genways bulk human
GWB-BIG15D Recombinant Murine IL-17 (IL-17A) bulk Ask price € genways bulk human
6588 Recombinant Ovine IL-17A 5 µg 220 € Immunochemistry kits ovine
6530 Recombinant Rabbit IL-17A 5 µg 220 € Immunochemistry kits human
6531 Recombinant Rat IL-17A 5 µg 220 € Immunochemistry kits rat
GWB-BB38C1 Recombinant Rat Interleukin-17A bulk Ask price € genways bulk rat
6428 Recombinant Swine IL-17A 5 µg 220 € Immunochemistry kits human
103-P76 Anti-Mouse IL-17A 100ug 290 € Reliatech antibodies mouse
GENTAUR-58bd78eb54587 Mouse Interleukin-17A (Il17a) 100ug 1453 € MBS Recombinant Proteins mouse
GENTAUR-58bd78ebb68d7 Mouse Interleukin-17A (Il17a) 1000ug 1453 € MBS Recombinant Proteins mouse
GENTAUR-58bd78ec0e6b2 Mouse Interleukin-17A (Il17a) 100ug 1956 € MBS Recombinant Proteins mouse