| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Ephrin-B1 is produced by our Mammalian expression system and the target gene encoding Leu28-Gly232 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
23, 4 kD |
| UniProt number: |
P98172 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
LAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
EFNB1 (C-6His), Ephrin-B1 |
| Short name: |
EFNB1 (C-6His), Recombinant Ephrin-B1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
ephrin-B1 (C-6His), sapiens Ephrin-B1, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CFND and CFNS and EFB1 and EFL3 and Elk-L and EPLG2 and LERK2, EFNB1 and IDBG-636377 and ENSBTAG00000015801 and 534413, EFNB1 and IDBG-74050 and ENSG00000090776 and 1947, Efnb1 and IDBG-161815 and ENSMUSG00000031217 and 13641, ephrin receptor binding, nuclei, this GO :0001755 and neural crest cell migration and biological process this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0007411 and axon guidance and biological process this GO :0009880 and embryonic pattern specification and biological process this GO :0016020 and membrane and cellular component this GO :0042102 and positive regulation of T cell proliferation and biological process this GO :0045121 and membrane raft and cellular component this GO :0045202 and synapse and cellular component this GO :0046875 and ephrin receptor binding and molecular function this GO :0048013 and ephrin receptor signaling pathway and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0046875 : ephrin receptor binding, this GO :0046875 : ephrin receptor binding, ephrin-B1 |
| Identity: |
3226 |
| Gene: |
EFNB1 |
More about : EFNB1 |
| Long gene name: |
ephrin B1 |
| Synonyms gene: |
EPLG2 CFNS |
| Synonyms gene name: |
craniofrontonasal syndrome (craniofrontonasal dysplasia) ephrin-B1 |
| Synonyms: |
LERK2 Elk-L |
| Locus: |
Xq13, 1 |
| Discovery year: |
1995-01-17 |
| GenBank acession: |
U09303 |
| Entrez gene record: |
1947 |
| Pubmed identfication: |
7774950 16526919 |
| RefSeq identity: |
NM_004429 |
| Classification: |
Ephrins |
| Havana BLAST/BLAT: |
OTTHUMG00000021751 |
| Locus Specific Databases: |
Mental Retardation database |