Recombinant Mouse LAIR1 (C-6His)

Contact us
Catalog number: CC26
Price: 470 €
Supplier: MBS Polyclonals
Product name: Recombinant Mouse LAIR1 (C-6His)
Quantity: 100ug
Other quantities: 1 mg 1674€ 10 µg 141€ 500 µg 1186€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Leukocyte-associated Immunoglobulin-like Receptor 1 is produced by our Mammalian expression system and the target gene encoding Gln22-Tyr141 is expressed with a 6His tag at the C-terminus
Molecular Weight: 14, 4 kD
UniProt number: Q8BG84
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QEGSLPDITIFPNSSLMISQGTFVTVVCSYSDKHDLYNMVRLEKDGSTFMEKSTEPYKTEDEFEIGPVNETITGHYSCIYSKGITWSERSKTLELKVIKENVIQTPAPGPTSDTSWLKTYHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: LAIR1 (C-6His)
Short name: Recombinant Mouse LAIR1 (C-6His)
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: recombinant Mouse leukocyte-associated immunoglobulin-like receptor 1 (C-6His)
Alternative technique: rec
Alternative to gene target: CD305 and LAIR-1, LAIR1 and IDBG-68573 and ENSG00000167613 and 3903, Plasma membranes, protein binding, this GO :0002376 and immune system process and biological process this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0045087 and innate immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0005515 : protein binding, this GO :0005515 : protein binding, leukocyte-associated immunoglobulin-like receptor 1
Identity: 6477
Gene: LAIR1 | More about : LAIR1
Long gene name: leukocyte associated immunoglobulin like receptor 1
Synonyms gene name: leukocyte-associated Ig-like receptor 1 leukocyte-associated immunoglobulin-like receptor 1
Synonyms: CD305
Locus: 19q13, 42
Discovery year: 1997-07-25
GenBank acession: AF013249
Entrez gene record: 3903
Pubmed identfication: 9285412
Classification: CD molecules Immunoglobulin like domain containing
Havana BLAST/BLAT: OTTHUMG00000065545

Related Products :

CC26 Recombinant Mouse LAIR1 (C-6His) 50 µg 303 € novo mouse
RP-1385M Recombinant Mouse LAIR1 Protein (Fc Tag) 50μg 624 € adv mouse
RP-1386M Recombinant Mouse LAIR1 Protein (His Tag) 50μg 624 € adv mouse
RP-0979H Recombinant Human LAIR1 Protein (Fc Tag) 50μg 624 € adv human
RP-0978H Recombinant Human LAIR1 Protein (His Tag) 50μg 624 € adv human
GENTAUR-58bde60b984cc Mouse Monoclonal [clone LC12] (IgG1,k) to Human LAIR1 / CD305 Antibody 50ug 597 € MBS mono human
SA6036 anti-CD305 / LAIR1 (22-125) Antibody 0,1 mg 587 € acr human
SA6036X anti-CD305 / LAIR1 (22-125) Antibody 0,5 mg 1486 € acr human
SM2048F anti-CD305 / LAIR1 Antibody 0,1 mg 601 € acr human
SM2048FT anti-CD305 / LAIR1 Antibody 25 Вµg 326 € acr human
SM2048P anti-CD305 / LAIR1 Antibody 0,2 mg 746 € acr human
SM2048PS anti-CD305 / LAIR1 Antibody 0,1 mg 442 € acr human
SM2048PT anti-CD305 / LAIR1 Antibody 25 Вµg 311 € acr human
SM2048R anti-CD305 / LAIR1 Antibody 100 Tests 732 € acr human
SM2048RT anti-CD305 / LAIR1 Antibody 25 Tests 369 € acr human
SM6003 anti-CD305 / LAIR1 Antibody 0,1 ml 471 € acr human
SM6003S anti-CD305 / LAIR1 Antibody 50 Вµl 384 € acr human
abx152153 Anti-Human LAIR1 ELISA Kit inquire 50 € abbex human
abx572770 Anti-Human LAIR1 ELISA Kit 96 tests 760 € abbex human
GENTAUR-58bdfad276db8 Anti- LAIR1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdfad2dbb15 Anti- LAIR1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be10fbabdc8 Anti- LAIR1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be10fc07324 Anti- LAIR1 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be125d86dd0 Anti- LAIR1 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be125dd09a7 Anti- LAIR1 Antibody 0.12 ml 348 € MBS Polyclonals human
abx136030 Anti-LAIR1 Antibody 10 μl 108 € abbex human
abx902923 Anti-LAIR1 siRNA inquire 50 € abbex human
abx922211 Anti-LAIR1 siRNA 30 nmol 717 € abbex human
abx922212 Anti-LAIR1 siRNA 15 nmol 528 € abbex human
GENTAUR-58bdc6cbdb9aa Anti- Leukocyte Associated Immunoglobulin Like Receptor 1 (LAIR1) Antibody 100ug 470 € MBS Polyclonals human