Recombinant Mouse Pulmonary Surfactant-associated Protein D, SP-D (C-6His)

Contact us
Catalog number: CB54
Price: 1315 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Mouse Pulmonary Surfactant-associated Protein D, SP-D (C-6His)
Quantity: 1000ug
Other quantities: 1 mg 1318€ 10 µg 126€ 50 µg 278€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Pulmonary Surfactant-associated Protein D is produced by our Mammalian expression system and the target gene encoding Ala20-Phe374 is expressed with a 6His tag at the C-terminus
Molecular Weight: 36, 7 kD
UniProt number: P50404
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: AEMKSLSQRSVPNTCTLVMCSPTENGLPGRDGRDGREGPRGEKGDPGLPGPMGLSGLQGPTGPVGPKGENGSAGEPGPKGERGLSGPPGLPGIPGPAGKEGPSGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSTGAKGSTGPKGERGAPGVQGAPGNAGAAGPAGPAGPQGAPGSRGPPGLKGDRGVPGDRGIKGESGLPDSAALRQQMEALKGKLQRLEVAFSHYQKAALFPDGRSVGDKIFRTADSEKPFEDAQEMCKQAGGQLASPRSATENAAIQQLITAHNKAAFLSMTDVGTEGKFTYPTGEPLVYSNWAPGEPNNNGGAENCVEIFTNGQWNDKACGEQRLVICEFVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: SP-D (C-6His), Pulmonary Surfactant-associated Protein D
Short name: SP-D (C-6His), Recombinant Mouse Pulmonary Surfactant-associated Protein D
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: SP-D (C-6His), recombinant Mouse Pulmonary Surfactant-associated Protein D
Alternative technique: rec
Identity: 10803
Gene: SFTPD | More about : SFTPD
Long gene name: surfactant protein D
Synonyms gene: SFTP4
Synonyms gene name: pulmonary-associated protein D , surfactant
Synonyms: SP-D COLEC7
Locus: 10q22, 3
Discovery year: 1992-06-26
GenBank acession: L05485
Entrez gene record: 6441
Pubmed identfication: 1898081 1339284
Classification: Collectins C-type lectin domain containing
Havana BLAST/BLAT: OTTHUMG00000018590

Related Products :

CB54 Recombinant Mouse Pulmonary Surfactant-associated Protein D, SP-D (C-6His) 500 µg 963 € novo mouse
C541 Recombinant Human Pulmonary Surfactant-Associated Protein D, PSP-D (C-6His) 500 µg 1613 € novo human
abx254433 Anti-Mouse Pulmonary Surfactant Associated Protein A ELISA Kit 96 tests 557 € abbex mouse
abx255008 Anti-Mouse Pulmonary Surfactant Associated Protein C ELISA Kit 96 tests 659 € abbex mouse
abx254549 Anti-Mouse Pulmonary Surfactant Associated Protein D ELISA Kit inquire 50 € abbex mouse
abx253197 Anti-Human Pulmonary Surfactant Associated Protein A ELISA Kit 96 tests 557 € abbex human
abx251167 Anti-Human Pulmonary Surfactant Associated Protein B ELISA Kit inquire 50 € abbex human
abx251168 Anti-Human Pulmonary Surfactant Associated Protein C ELISA Kit inquire 50 € abbex human
abx253200 Anti-Human Pulmonary Surfactant Associated Protein D ELISA Kit inquire 50 € abbex human
abx256021 Anti-Rat Pulmonary Surfactant Associated Protein C ELISA Kit inquire 50 € abbex rat
abx256022 Anti-Rat Pulmonary Surfactant Associated Protein D ELISA Kit inquire 50 € abbex rat
AE19843HO-48 ELISA test for Horse Pulmonary surfactant-associated protein A (SFTPA1) 1x plate of 48 wells 402 € abebio horse
AE19831HU-48 ELISA test for Human Pulmonary surfactant-associated protein B (SP-B) 1x plate of 48 wells 373 € abebio human
AE19819RA-48 ELISA test for Rat Pulmonary Surfactant-associated protein D (SP-D) 1x plate of 48 wells 402 € abebio rat
AE19837SH-48 ELISA test for Sheep Pulmonary surfactant-associated protein A (SFTPA1) 1x plate of 48 wells 402 € abebio sheep
AE17498SH-48 ELISA test for Sheep Pulmonary surfactant-associated protein B (SP-B) 1x plate of 48 wells 373 € abebio sheep
AE59695SH-48 ELISA test for Sheep Pulmonary surfactant-associated protein C (SP-C) 1x plate of 48 wells 373 € abebio sheep
AE19843HO-96 Horse Pulmonary surfactant-associated protein A (SFTPA1) ELISA Kit 1x plate of 96 wells 671 € abebio horse
AE19831HU Human Pulmonary surfactant-associated protein B (SP-B) ELISA Kit 96 wells plate 769 € ab-elisa elisas human
AE19831HU-96 Human Pulmonary surfactant-associated protein B (SP-B) ELISA Kit 1x plate of 96 wells 612 € abebio human
GENTAUR-58bd57c23a942 Pig Pulmonary surfactant-associated protein B 1 mg 1475 € MBS Recombinant Proteins pig
GENTAUR-58bd57c2844bf Pig Pulmonary surfactant-associated protein B 0.05 mg 265 € MBS Recombinant Proteins pig
GENTAUR-58bd57c2c9b0d Pig Pulmonary surfactant-associated protein B 0.2 mg 564 € MBS Recombinant Proteins pig
GENTAUR-58bd57c319106 Pig Pulmonary surfactant-associated protein B 0.5 mg 951 € MBS Recombinant Proteins pig
GENTAUR-58ba39e4f3a21 Rat Pulmonary surfactant-associated protein A (Sftpa1) 100ug 1685 € MBS Recombinant Proteins rat
GENTAUR-58ba39e58305c Rat Pulmonary surfactant-associated protein A (Sftpa1) 1000ug 1685 € MBS Recombinant Proteins rat
GENTAUR-58ba39e61f33e Rat Pulmonary surfactant-associated protein A (Sftpa1) 100ug 2199 € MBS Recombinant Proteins rat
GENTAUR-58ba39e6d3c30 Rat Pulmonary surfactant-associated protein A (Sftpa1) 1000ug 2199 € MBS Recombinant Proteins rat
GENTAUR-58b9b8de71998 Rat Pulmonary surfactant-associated protein B (Sftpb) 100ug 1315 € MBS Recombinant Proteins rat
GENTAUR-58b9b8dee33d3 Rat Pulmonary surfactant-associated protein B (Sftpb) 1000ug 1315 € MBS Recombinant Proteins rat