Recombinant Mouse Folate Receptor Alpha, FOLR1 (C-6His)

Contact us
Catalog number: CB52
Price: 735 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Mouse Folate Receptor Alpha, FOLR1 (C-6His)
Quantity: 100ug
Other quantities: 1 mg 1318€ 10 µg 126€ 50 µg 278€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: FOLR1 (C-6His) is a &alpha, - or alpha protein sometimes glycoprotein present in blood, The Recombinant Mouse Folate Receptor Alpha
Molecular Weight: 25, 3 kD
UniProt number: P35846
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: TRARTELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGTMTSECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMSVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: FOLR1 (C-6His), Folate Receptor Alpha
Short name: FOLR1 (C-6His), Recombinant Mouse Folate Receptor Alpha
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: folate receptor 1 (adult) (C-6His), recombinant Mouse Folate Receptor a
Alternative technique: rec
Alternative to gene target: FBP and FOLR, FOLR1 and IDBG-63244 and ENSG00000110195 and 2348, Folr1 and IDBG-202269 and ENSMUSG00000001827 and 14275, Plasma membranes, folic acid transporter activity, this GO :0004872 and receptor activity and molecular function this GO :0005542 and folic acid binding and molecular function this GO :0005768 and endosome and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0005903 and brush border and cellular component this GO :0006898 and receptor-mediated endocytosis and biological process this GO :0008219 and cell death and biological process this GO :0008517 and folic acid transporter activity and molecular function this GO :0015884 and folic acid transport and biological process this GO :0016020 and membrane and cellular component this GO :0016324 and apical plasma membrane and cellular component this GO :0030136 and clathrin-coated vesicle and cellular component this GO :0031362 and anchored component of external side of plasma membrane and cellular component this GO :0031526 and brush border membrane and cellular component this GO :0046655 and folic acid metabolic process and biological process this GO :0046658 and anchored component of plasma membrane and cellular component this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0005542 : folic acid binding and also this GO :0008517 : folic acid transporter activity, this GO :0005542 : folic acid binding, this GO :0008517 : folic acid transporter activity, folate receptor 1 (adult)
Identity: 3791
Gene: FOLR1 | More about : FOLR1
Long gene name: folate receptor 1
Synonyms gene: FOLR
Synonyms gene name: folate receptor 1 (adult)
Synonyms name: folate receptor alpha
Locus: 11q13, 4
Discovery year: 1991-08-08
GenBank acession: J05013
Entrez gene record: 2348
Pubmed identfication: 1717147
RefSeq identity: NM_016725
Havana BLAST/BLAT: OTTHUMG00000167876

Related Products :

MBS620439 Folate receptor 1 (FOLR1) (folate receptor 1 (adult) Adult folate-binding protein, FBP, Folate receptor, adult, Folate receptor 1, Folate receptor alpha, FR-alpha, KB cells FBP, MOv18, Ovarian tumor-associated antigen MOv18) Antibody 100ug 774 € MBS Polyclonals_1 human
MBS624431 Folate Binding Protein (FBP, Folate Receptor 1 Adult, Folate Receptor 1 Precursor, FOLR1, FRalpha, KB Cells FBP, MOV18 Ovarian Cancer Associated Antigen, Ovarian Tumor Associated Antigen) (HRP) 2 miligrams 614 € MBS Polyclonals_1 human
CB52 Recombinant Mouse Folate Receptor Alpha, FOLR1 (C-6His) 10 µg 126 € novo mouse
C784 Recombinant Human Folate Receptor α, FOLR1 (C-6His) 10 µg 146 € novo human
RP-1680H Recombinant Human FOLR1 / Folate receptor alpha Protein (His Tag) 50μg 624 € adv human
RP-2135R Recombinant Rat FOLR1 / Folate Receptor 1 Protein (Fc Tag) 50μg 624 € adv rat
AE43372BO Bovine Folate receptor alpha (FOLR1) ELISA Kit 96 wells plate 810 € ab-elisa elisas bovine
AE43372BO-96 Bovine Folate receptor alpha (FOLR1) ELISA Kit 1x plate of 96 wells 671 € abebio bovine
AE43372BO-48 ELISA test for Bovine Folate receptor alpha (FOLR1) 1x plate of 48 wells 402 € abebio bovine
abx576232 Anti-Mouse Folate Receptor 1, Adult (FOLR1) ELISA Kit inquire 50 € abbex mouse
DL-FOLR1-Mu Mouse Folate Receptor 1, Adult FOLR1 ELISA Kit 96T 921 € DL elisas mouse
GENTAUR-58bdcaa3aa60a Anti- Folate Receptor 1, Adult (FOLR1) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdcaa413746 Anti- Folate Receptor 1, Adult (FOLR1) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdcf4d553bb Anti- Folate Receptor 1, Adult (FOLR1) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdcf4d94787 Anti- Folate Receptor 1, Adult (FOLR1) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdd2c5078ff Anti- Folate Receptor 1, Adult (FOLR1) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd35494998 Anti- Folate Receptor 1, Adult (FOLR1) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdda8d2a258 Anti- Folate Receptor 1, Adult (FOLR1) Antibody 100ug 603 € MBS Polyclonals human
GENTAUR-58bddc92323e4 Anti- Folate Receptor 1, Adult (FOLR1) Antibody 100ug 564 € MBS Polyclonals human
abx574852 Anti-Human Folate Receptor 1, Adult (FOLR1) ELISA Kit inquire 50 € abbex human
EKU04244 Folate Receptor 1, Adult (FOLR1) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
EKU04245 Folate Receptor 1, Adult (FOLR1) ELISA kit 1 plate of 96 wells 844 € Biomatik ELISA kits human
DL-FOLR1-Hu Human Folate Receptor 1, Adult FOLR1 ELISA Kit 96T 904 € DL elisas human
RFC11-P Human Folate Transporter (RFC, reduced folate carrier) control/blocking peptide # 1 100 μg 188 € adi human
RFC11-A Rabbit Anti-human Folate Transporter (RFC reduced folate carrier) 100 μg 565 € adi human
RFC12-A Rabbit Anti-Rat Folate Transporter (RFC reduced folate carrier) 100 μg 565 € adi rat
RFC12-P Rat Folate Transporter (RFC, reduced folate carrier) control/blocking peptide # 2 100 μg 188 € adi rat
RP-1641M Recombinant Mouse FOLR1 / FR-alpha Protein (His Tag) 50μg 624 € adv mouse
MBS619896 Nuclear Receptor LXR alpha, beta (Liver X Receptor alpha, Liver X Receptor beta, LX Receptor alpha, LX Receptor beta, LXRa, LXR-a, LXRalpha, LXRb, LXR-b, LXRbeta, NERI, NER-I, NR1H2, NR1H3, Nuclear Receptor NER, Nuclear Receptor Subfamily 1 Group H Member 100ug 763 € MBS Polyclonals_1 human
MBS611189 Nuclear Receptor LXR alpha, beta (Liver X Receptor alpha, Liver X Receptor beta, LX Receptor alpha, LX receptor beta, LXRa, LXRalpha, LXRb, LXRbeta, NERI, NR1H2, NR1H3, Nuclear Orphan Receptor LXR alpha, Nuclear Orphan Receptor LXR beta, Nuclear Receptor Antibody 100ug 735 € MBS Polyclonals_1 human