| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
FOLR1 (C-6His) is a &alpha, - or alpha protein sometimes glycoprotein present in blood, The Recombinant Mouse Folate Receptor Alpha |
| Molecular Weight: |
25, 3 kD |
| UniProt number: |
P35846 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
TRARTELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGTMTSECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMSVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or  |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
FOLR1 (C-6His), Folate Receptor Alpha |
| Short name: |
FOLR1 (C-6His), Recombinant Mouse Folate Receptor Alpha |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
folate receptor 1 (adult) (C-6His), recombinant Mouse Folate Receptor a |
| Alternative technique: |
rec |
| Alternative to gene target: |
FBP and FOLR, FOLR1 and IDBG-63244 and ENSG00000110195 and 2348, Folr1 and IDBG-202269 and ENSMUSG00000001827 and 14275, Plasma membranes, folic acid transporter activity, this GO :0004872 and receptor activity and molecular function this GO :0005542 and folic acid binding and molecular function this GO :0005768 and endosome and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0005903 and brush border and cellular component this GO :0006898 and receptor-mediated endocytosis and biological process this GO :0008219 and cell death and biological process this GO :0008517 and folic acid transporter activity and molecular function this GO :0015884 and folic acid transport and biological process this GO :0016020 and membrane and cellular component this GO :0016324 and apical plasma membrane and cellular component this GO :0030136 and clathrin-coated vesicle and cellular component this GO :0031362 and anchored component of external side of plasma membrane and cellular component this GO :0031526 and brush border membrane and cellular component this GO :0046655 and folic acid metabolic process and biological process this GO :0046658 and anchored component of plasma membrane and cellular component this GO :0070062 and extracellular vesicular exosome and cellular component, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0005542 : folic acid binding and also this GO :0008517 : folic acid transporter activity, this GO :0005542 : folic acid binding, this GO :0008517 : folic acid transporter activity, folate receptor 1 (adult) |
| Identity: |
3791 |
| Gene: |
FOLR1 |
More about : FOLR1 |
| Long gene name: |
folate receptor 1 |
| Synonyms gene: |
FOLR |
| Synonyms gene name: |
folate receptor 1 (adult) |
| Synonyms name: |
folate receptor alpha |
| Locus: |
11q13, 4 |
| Discovery year: |
1991-08-08 |
| GenBank acession: |
J05013 |
| Entrez gene record: |
2348 |
| Pubmed identfication: |
1717147 |
| RefSeq identity: |
NM_016725 |
| Havana BLAST/BLAT: |
OTTHUMG00000167876 |