| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Syntenin-1 is produced by our E, coli expression system and the target gene encoding Ser2-Val299 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
33, 4 kD |
| UniProt number: |
O08992 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MSLYPSLEDLKVDKVIQAQTAYSANPASQAFVLVDASAALPPDGNLYPKLYPELSQYMGLSLNEAEICESMPMVSGAPAQGQLVARPSSVNYMVAPVTGNDAGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTVTMHKDSSGHVGFIFKSGKITSIVKDSSAARNGLLTDHHICEINGQNVIGLKDAQIADILSTAGTVVTITIMPTFIFEHIIKRMAPSIMKSLMDHTIPEVLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
SDCBP (C-6His), Syntenin-1, Syndecan-Binding Protein 1 |
| Short name: |
SDCBP (C-6His), Syntenin-1, Recombinant Mouse Syndecan-Binding Protein 1 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
Syntenin-1, syndecan binding protein (syntenin) (C-6His), recombinant Mouse Syndecan-Binding Protein 1 |
| Alternative technique: |
rec |
| Alternative to gene target: |
MDA-9 and MDA9 and ST1 and SYCL and TACIP18, SDCBP and IDBG-22706 and ENSG00000137575 and 6386, SDCBP and IDBG-644487 and ENSBTAG00000019910 and 510979, Sdcbp and IDBG-128595 and ENSMUSG00000028249 and 53378, cell adhesion molecule binding, cell extension and biological process this GO :0007265 and Ras protein signal transduction and biological process this GO :0007268 and synaptic transmission and biological process this GO :0007411 and axon guidance and biological process this GO :0008022 and protein C-terminus binding and molecular function this GO :0008093 and cytoskeletal adaptor activity and molecular function this GO :0016020 and membrane and cellular component this GO :0019838 and growth factor binding and molecular function this GO :0030036 and actin cytoskeleton organization and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0042043 and neurexin family protein binding and molecular function this GO :0042327 and positive regulation of phosphorylation and biological process this GO :0042470 and melanosome and cellular component this GO :0042802 and identical protein binding and molecular function this GO :0042803 and protein homodimerization activity and molecular function this GO :0045545 and syndecan binding and molecular function this GO :0046330 and positive regulation of JNK cascade and biological process this GO :0046875 and ephrin receptor binding and molecular function this GO :0046982 and protein heterodimerization activity and molecular function this GO :0047485 and protein N-terminus binding and molecular function this GO :0050839 and cell adhesion molecule binding and molecular function this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0072562 and blood microparticle and cellular component, nuclei, this GO :0001948 and glycoprotein binding and molecular function this GO :0005109 and frizzled binding and molecular function this GO :0005137 and interleukin-5 receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005789 and endoplasmic reticulum membrane and cellular component this GO :0005829 and cytosol and cellular component this GO :0005856 and cytoskeleton and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005895 and interleukin-5 receptor complex and cellular component this GO :0005912 and adherens junction and cellular component this GO :0005925 and focal adhesion and cellular component this GO :0006612 and protein targeting to membrane and biological process this GO :0006930 and substrate-dependent cell migration, this GO :0001948 : glycoprotein binding, this GO :0001948 : glycoprotein binding and also this GO :0005109 : frizzled binding and also this GO :0005137 : interleukin-5 receptor binding and also this GO :0005515 : protein binding and also this GO :0008022 : protein C-terminus binding and also this GO :0008093 : cytoskeletal adaptor activity and also this GO :0019838 : growth factor binding and also this GO :0042043 : neurexin family protein binding and also this GO :0042802 : identical protein binding and also this GO :0042803 : protein homodimerization activity and also this GO :0045545 : syndecan binding and also this GO :0046875 : ephrin receptor binding and also this GO :0046982 : protein heterodimerization activity and also this GO :0047485 : protein N-terminus binding and also this GO :0050839 : cell adhesion molecule binding, this GO :0005109 : frizzled binding, this GO :0005137 : interleukin-5 receptor binding, this GO :0005515 : protein binding, this GO :0008022 : protein C-terminus binding, this GO :0008093 : cytoskeletal adaptor activity, this GO :0019838 : growth factor binding, this GO :0042043 : neurexin family protein binding, this GO :0042802 : identical protein binding, this GO :0042803 : protein homodimerization activity, this GO :0045545 : syndecan binding, this GO :0046875 : ephrin receptor binding, this GO :0046982 : protein heterodimerization activity, this GO :0047485 : protein N-terminus binding, this GO :0050839 : cell adhesion molecule binding, syndecan binding protein (syntenin) |
| Identity: |
10662 |
| Gene: |
SDCBP |
More about : SDCBP |
| Long gene name: |
syndecan binding protein |
| Synonyms: |
SYCL MDA-9 |
| Synonyms name: |
syntenin syntenin-1 |
| Locus: |
8q12, 1 |
| Discovery year: |
1998-02-11 |
| GenBank acession: |
AF000652 |
| Entrez gene record: |
6386 |
| Pubmed identfication: |
9391086 |
| RefSeq identity: |
NM_005625 |
| Classification: |
PDZ domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000164303 |