Recombinant Mouse Dickkopf-Related Protein 1, mDKK1, DKK-1 (N-8His)

Contact us
Catalog number: C773
Price: 156 €
Supplier: novo
Product name: Recombinant Mouse Dickkopf-Related Protein 1, mDKK1, DKK-1 (N-8His)
Quantity: 10 µg
Other quantities: 1 mg 2486€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Dickkopf-related protein 1 is produced by our Mammalian expression system and the target gene encoding Thr32-His272 is expressed with a 8His tag at the N-terminus
Molecular Weight: 27, 4 kD
UniProt number: O54908
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: HHHHHHHHQTLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASNSSRLHTCQRH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: DKK-1 (N-8His), mDKK1, Dickkopf-Related Protein 1
Short name: DKK-1 (N-8His), mDKK1, Recombinant Mouse Dickkopf- Protein 1
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: DKK-1 (N-8His), mDKK1, recombinant Mouse Dickkopf-Related Protein 1
Alternative technique: rec
Identity: 2891
Gene: DKK1 | More about : DKK1
Long gene name: dickkopf WNT signaling pathway inhibitor 1
Synonyms gene name: dickkopf (Xenopus laevis) homolog 1 dickkopf 1 homolog (Xenopus laevis)
Synonyms: SK DKK-1
Locus: 10q21, 1
Discovery year: 2000-09-01
Entrez gene record: 22943
Havana BLAST/BLAT: OTTHUMG00000018247

Related Products :

MBS610010 Dkk-1 (Dickkopf 1, Dickkopf 1-like, Dickkopf Homolog 1, Dickkopf-related Protein 1, DKK 1, hDkk 1, SK) Antibody 100ug 774 € MBS Polyclonals_1 human
MBS610460 Dkk-1 (Dickkopf 1, Dickkopf 1-like, Dickkopf Homolog 1, Dickkopf-related Protein 1, DKK 1, hDkk 1, SK) Antibody 50ug 724 € MBS Polyclonals_1 human
MBS612812 Dkk-1 (Dickkopf 1, Dickkopf 1-like, Dickkopf Homolog 1, Dickkopf-related Protein 1, DKK 1, hDkk 1, SK) Antibody 50ug 724 € MBS Polyclonals_1 human
MBS613625 Dkk-1 (Dickkopf 1, Dickkopf 1-like, Dickkopf Homolog 1, Dickkopf-related Protein 1, DKK 1, hDkk 1, SK) Antibody 100ug 735 € MBS Polyclonals_1 human
C773 Recombinant Mouse Dickkopf-Related Protein 1, mDKK1, DKK-1 (N-8His) 500 µg 1613 € novo mouse
MBS610035 Dkk-1 (DKK1, SK, DKK-1, Dickkopf Homolog 1 (Xenopus laevis), Dickkopf-1 Like, Dickkopf (Xenopus laevis) Homolog 1) 100ug 591 € MBS Polyclonals_1 xenopus
MBS611235 Dkk-1 (DKK1, SK, DKK-1, Dickkopf Homolog 1 (Xenopus laevis), Dickkopf-1 Like, Dickkopf (Xenopus laevis) Homolog 1) Antibody 100ug 663 € MBS Polyclonals_1 xenopus
MBS611995 Dkk-1 (DKK1, SK, DKK-1, Dickkopf Homolog 1 (Xenopus laevis), Dickkopf-1 Like, Dickkopf (Xenopus laevis) Homolog 1) Antibody 100ul 564 € MBS Polyclonals_1 xenopus
MBS610284 Dkk-2 (DKK2, SK, DKK-2, Dickkopf Homolog 2 (Xenopus laevis), Dickkopf-2 Like, Dickkopf (Xenopus laevis) Homolog 2) 100ug 735 € MBS Polyclonals_1 xenopus
MBS611962 Dkk-2 (DKK2, SK, DKK-2, Dickkopf Homolog 2 (Xenopus laevis), Dickkopf-2 Like, Dickkopf (Xenopus laevis) Homolog 2) Antibody 100ul 564 € MBS Polyclonals_1 xenopus
MBS614273 Dkk-2 (DKK2, SK, DKK-2, Dickkopf Homolog 2 (Xenopus laevis), Dickkopf-2 Like, Dickkopf (Xenopus laevis) Homolog 2) Antibody 100ul 564 € MBS Polyclonals_1 xenopus
MBS620423 Dkk-1 (Dickkopf-1, DKK1, SK, hDKK-1, Dickkopf Homolog 1 (Xenopus laevis), Dickkopf-1 like, Dickkopf (Xenopus laevis) Homolog 1) Antibody 50ug 928 € MBS Polyclonals_1 xenopus
MBS623444 Dkk-2, NT (Dickkopf Related Protein-2, Dickkopf-2, DKK-2, UNQ682/PRO1316) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS624462 DKK4, NT (Dickkopf-related Protein 4, Dickkopf-4, Dkk-4) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS617798 Dkk-4 (DKK4, Dickkopf Gene 4, Dickkopf Homolog 4) Antibody 100ug 735 € MBS Polyclonals_1 human
MBS621138 Dkk-4 (DKK4, Dickkopf Gene 4, Dickkopf Homolog 4) Antibody 100ug 564 € MBS Polyclonals_1 human
C688 Recombinant Human Dickkopf-Related Protein 1, DKK1 (N-8His) 10 µg 202 € novo human
CC49 Recombinant Human Dickkopf-Related Protein 2, DKK-2 (N-Fc, C-6His) 50 µg 369 € novo human
MBS620810 Dkk-3 (Dickkopf Homolog 3, REIC) Antibody 100ug 564 € MBS Polyclonals_1 human
CC27 Recombinant Mouse Fibrillin-1, Asprosin (N-8His) 10 µg 202 € novo mouse
CM74 Recombinant Mouse OX40 Ligand, TNFSF4, OX40L (N-8His) 50 µg 369 € novo mouse
CM20 Recombinant Carassius Auratus Leptin (N-8His) 500 µg 1613 € novo human
CP72 Recombinant Cynomolgus Tumor Necrosis Factor Ligand 2B, OX40L(N-8His) 500 µg 2536 € novo human
CS40 Recombinant Human Fc epsilon RII, CD23 (N-8His) 500 µg 1613 € novo human
CP84 Recombinant Human Fibrillin-1, Asprosin (N-8His) 50 µg 496 € novo human
CM21 Recombinant Human Isocitrate Dehydrogenase 1, IDH1 (C-8His) 50 µg 496 € novo human
CM34 Recombinant Human Isocitrate Dehydrogenase 1, IDH1 (R132H, C-8His) 1 mg 2283 € novo human
CB20 Recombinant Human NKG2-A, NKG2-B Type II Integral Membrane Protein(N-8His) 50 µg 141 € novo human
CS55 Recombinant Human NKG2A & CD94 Heterodimer (N-8His & N-Flag) 500 µg 1186 € novo human
C018 Recombinant Human Noggin, NOG (N-8His-Flag) 10 µg 156 € novo human