| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Angiopoietin Like protein 4 is produced by our Mammalian expression system and the target gene encoding Lys167-Ser410 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
54, 6 kD |
| UniProt number: |
Q9Z1P8 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Supplied as a 0, pH7 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
KRLPKMTQLIGLTPNATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAASVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
ANGPTL4 (C-Fc), Angiopoietin-Related Protein 4 |
| Short name: |
ANGPTL4 (C-Fc), Recombinant Mouse Angiopoietin- Protein 4 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
angiopoietin-like 4 (C-fragment c), recombinant Mouse Angiopoietin-Related Protein 4 |
| Alternative technique: |
rec |
| Alternative to gene target: |
ANGPTL4 and IDBG-24662 and ENSG00000167772 and 51129, ANGPTL4 and IDBG-643821 and ENSBTAG00000002473 and 509963, Angptl4 and IDBG-167867 and ENSMUSG00000002289 and 57875, Extracellular, protein binding, this GO :0001525 and angiogenesis and biological process this GO :0001666 and response to hypoxia and biological process this GO :0004857 and enzyme inhibitor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005578 and proteinaceous extracellular matrix and cellular component this GO :0005615 and extracellular space and cellular component this GO :0030154 and cell differentiation and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0044255 and cellular lipid metabolic process and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0045766 and positive regulation of angiogenesis and biological process this GO :0051005 and negative regulation of lipoprotein lipase activity and biological process this GO :0051260 and protein homooli this GO merization and biological process this GO :0070328 and triglyceride homeostasis and biological process this GO :0072562 and blood microparticle and cellular component this GO :2000352 and negative regulation of endothelial cell apoptotic process and biological process, this GO :0004857 : enzyme inhibitor activity, this GO :0004857 : enzyme inhibitor activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, angiopoietin-like 4 |
| Identity: |
16039 |
| Gene: |
ANGPTL4 |
More about : ANGPTL4 |
| Long gene name: |
angiopoietin like 4 |
| Synonyms gene name: |
angiopoietin-like 4 |
| Synonyms: |
pp1158 PGAR ARP4 HFARP FIAF NL2 |
| Synonyms name: |
fasting-induced adipose factor hepatic angiopoietin-related protein PPARG angiopoietin related protein hepatic fibrinogen/angiopoietin-related protein peroxisome proliferator-activated receptor (PPAR) gamma induced angiopoietin-related protein angiopoietin-related protein 4 |
| Locus: |
19p13, 2 |
| Discovery year: |
2001-07-18 |
| GenBank acession: |
AF202636 |
| Entrez gene record: |
51129 |
| Pubmed identfication: |
10698685 10866690 23960078 |
| RefSeq identity: |
NM_139314 |
| Classification: |
Fibrinogen C domain containing Angiopoietin like |
| Havana BLAST/BLAT: |
OTTHUMG00000182273 |