Recombinant Human Cathepsin S, CTSS (C-6His)

Contact us
Catalog number: C402
Price: 904 €
Supplier: DL elisas
Product name: Recombinant Human Cathepsin S, CTSS (C-6His)
Quantity: 96T
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Cathepsin S is produced by our Mammalian expression system and the target gene encoding Gln17-Ile331 is expressed with a 6His tag at the C-terminus
Molecular Weight: 36, 89 kD
UniProt number: P25774
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 10% Glycerol, 150 mM sodium chloride, pH 5, 2 um filtered solution of 20 mM MES, 5, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNWILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEIVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Gene: CTSS | More about : CTSS
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CTSS (C-6His), Cathepsin S
Short name: CTSS (C-6His), Recombinant Cathepsin S
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: cathepsin S (C-6His), sapiens Cathepsin S, recombinant H
Alternative technique: rec
Alternative to gene target: CTSS and IDBG-102189 and ENSG00000163131 and 1520, CTSS and IDBG-633332 and ENSBTAG00000017135 and 327711, Ctss and IDBG-172850 and ENSMUSG00000038642 and 13040, Extracellular, TAP-independent and biological process this GO :0004197 and cysteine-type endopeptidase activity and molecular function this GO :0005518 and collagen binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005764 and lysosome and cellular component this GO :0006508 and proteolysis and biological process this GO :0006955 and immune response and biological process this GO :0008233 and peptidase activity and molecular function this GO :0008234 and cysteine-type peptidase activity and molecular function this GO :0016020 and membrane and cellular component this GO :0019882 and antigen processing and presentation and biological process this GO :0019886 and antigen processing and presentation of exogenous peptide antigen via MHC class II and biological process this GO :0022617 and extracellular matrix disassembly and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030574 and collagen catabolic process and biological process this GO :0034769 and basement membrane disassembly and biological process this GO :0036021 and endolysosome lumen and cellular component this GO :0042590 and antigen processing and presentation of exogenous peptide antigen via MHC class I and biological process this GO :0043202 and lysosomal lumen and cellular component this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0043236 and laminin binding and molecular function this GO :0043394 and proteoglycan binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0050729 and positive regulation of inflammatory response and biological process this GO :0051603 and proteolysis involved in cellular protein catabolic process and biological process this GO :0097067 and cellular response to thyroid hormone stimulus and biological process, proteoglycan binding, this GO :0001968 and fibronectin binding and molecular function this GO :0002224 and toll-like receptor signaling pathway and biological process this GO :0002250 and adaptive immune response and biological process this GO :0002474 and antigen processing and presentation of peptide antigen via MHC class I and biological process this GO :0002480 and antigen processing and presentation of exogenous peptide antigen via MHC class I, this GO :0001968 : fibronectin binding, this GO :0001968 : fibronectin binding and also this GO :0004197 : cysteine-type endopeptidase activity and also this GO :0005518 : collagen binding and also this GO :0008233 : peptidase activity and also this GO :0008234 : cysteine-type peptidase activity and also this GO :0043236 : laminin binding and also this GO :0043394 : proteoglycan binding, this GO :0004197 : cysteine-type endopeptidase activity, this GO :0005518 : collagen binding, this GO :0008233 : peptidase activity, this GO :0008234 : cysteine-type peptidase activity, this GO :0043236 : laminin binding, this GO :0043394 : proteoglycan binding, cathepsin S
Identity: 2545
Long gene name: cathepsin S
Locus: 1q21, 3
Discovery year: 1992-07-09
GenBank acession: M90696
Entrez gene record: 1520
Pubmed identfication: 1373132
RefSeq identity: NM_004079
Classification: Cathepsins
Havana BLAST/BLAT: OTTHUMG00000035010

Related Products :

C402 Recombinant Human Cathepsin S, CTSS (C-6His) 500 µg 1613 € novo human
CM37 Recombinant Mouse Cathepsin S, CTSS (C-6His) 50 µg 496 € novo mouse
MBS624515 CTSH, NT (Cathepsin H, Cathepsin H Mini Chain, Cathepsin H Heavy Chain, Cathepsin H Light Chain, CPSB) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS624507 CTSK (ID R222) (Cathepsin K, Cathepsin O, Cathepsin X, Cathepsin O2, CTSO2, CTSO) Antibody 200ul 603 € MBS Polyclonals_1 human
CTHS24-N-10 Recombinant (HEK) Human Cathepsin S (CTSS) protein (>95%, his-tag low endotoxins) 10 μg 405 € adi human
RP-0226H Recombinant Human Cathepsin S / CTSS Protein (His Tag) 10μg 624 € adv human
RP-1081M Recombinant Mouse Cathepsin S / CTSS Protein (His Tag) 10μg 624 € adv mouse
abx570412 Anti-Human Cathepsin S (CTSS) ELISA Kit 96 tests 760 € abbex human
GWB-22CC94 Cathepsin S (CTSS) Goat antibody to or anti-Human Polyclonal antibody 1 x 1 vial 602 € genways human
MBS242108 Goat Polyclonal to Human CTSS / Cathepsin S Antibody 50ug 597 € MBS Polyclonals_1 human
DL-CTSS-Hu Human Cathepsin S CTSS ELISA Kit 96T 869 € DL elisas human
MBS248530 PAb (IgG) to Human CTSS / Cathepsin S Antibody 50ug 597 € MBS Polyclonals_1 human
GENTAUR-58bdc5ac3462b Anti- Cathepsin S (CTSS) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdc5acab49d Anti- Cathepsin S (CTSS) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdc70b34152 Anti- Cathepsin S (CTSS) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdca2a85c2f Anti- Cathepsin S (CTSS) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdca2ae57d9 Anti- Cathepsin S (CTSS) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdd2e694179 Anti- Cathepsin S (CTSS) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdd5ce844ba Anti- Cathepsin S (CTSS) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bdd67ab0931 Anti- Cathepsin S (CTSS) Antibody 100ug 542 € MBS Polyclonals human
abx576043 Anti-Mouse Cathepsin S (CTSS) ELISA Kit 96 tests 775 € abbex mouse
abx573400 Anti-Rat Cathepsin S (CTSS) ELISA Kit 96 tests 804 € abbex rat
EKU03040 Cathepsin S (CTSS) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
EKU03041 Cathepsin S (CTSS) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
EKU03042 Cathepsin S (CTSS) ELISA kit 1 plate of 96 wells 846 € Biomatik ELISA kits human
GENTAUR-58bcfb9993a7a Mouse Cathepsin S (Ctss) 100ug 1658 € MBS Recombinant Proteins mouse
GENTAUR-58bcfb99c9aad Mouse Cathepsin S (Ctss) 1000ug 1658 € MBS Recombinant Proteins mouse
GENTAUR-58bcfb9a203a5 Mouse Cathepsin S (Ctss) 100ug 2172 € MBS Recombinant Proteins mouse
GENTAUR-58bcfb9a6af69 Mouse Cathepsin S (Ctss) 1000ug 2172 € MBS Recombinant Proteins mouse
DL-CTSS-Mu Mouse Cathepsin S CTSS ELISA Kit 96T 904 € DL elisas mouse