Recombinant Human Oncostatin M, OSM (N-6His)

Contact us
Catalog number: C099
Price: 904 €
Supplier: DL elisas
Product name: Recombinant Human Oncostatin M, OSM (N-6His)
Quantity: 96T
Other quantities: 1 mg 2283€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Oncostatin M is produced by our E, coli expression system and the target gene encoding Ala26-Arg221 is expressed with a 6His tag at the N-terminus
Molecular Weight: 24, 44 kD
UniProt number: P13725
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: OSM (N-6His), Oncostatin M
Short name: OSM (N-6His), Recombinant Oncostatin M
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: oncostatin M (N-6His), sapiens Oncostatin M, recombinant H
Alternative technique: rec
Alternative to gene target: BT, Extracellular, OSM and IDBG-4002 and ENSG00000099985 and 5008, Osm and IDBG-142284 and ENSMUSG00000058755 and 18413, growth factor activity, this GO :0002675 and positive regulation of acute inflammatory response and biological process this GO :0005125 and cytokine activity and molecular function this GO :0005147 and oncostatin-M receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005900 and oncostatin-M receptor complex and cellular component this GO :0006955 and immune response and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0007422 and peripheral nervous system development and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008283 and cell proliferation and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0009408 and response to heat and biological process this GO :0033138 and positive regulation of peptidyl-serine phosphorylation and biological process this GO :0040008 and regulation of growth and biological process this GO :0042503 and tyrosine phosphorylation of Stat3 protein and biological process this GO :0042506 and tyrosine phosphorylation of Stat5 protein and biological process this GO :0042508 and tyrosine phosphorylation of Stat1 protein and biological process this GO :0043410 and positive regulation of MAPK cascade and biological process this GO :0045835 and negative regulation of meiosis and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046888 and negative regulation of hormone secretion and biological process this GO :0048266 and behavioral response to pain and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0051781 and positive regulation of cell division and biological process this GO :2001235 and positive regulation of apoptotic signaling pathway and biological process, this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity and also this GO :0005147 : oncostatin-M receptor binding and also this GO :0008083 : growth factor activity, this GO :0005147 : oncostatin-M receptor binding, this GO :0008083 : growth factor activity, 45038 and IDBG-636338 and ENSBTAG00000016163 and 319086, oncostatin M
Identity: 8506
Gene: OSM | More about : OSM
Long gene name: oncostatin M
Synonyms: MGC20461
Locus: 22q12, 2
Discovery year: 1992-07-09
GenBank acession: AF129855
Entrez gene record: 5008
Pubmed identfication: 1717982
RefSeq identity: NM_020530
Classification: Interleukin 6 cytokine family
Havana BLAST/BLAT: OTTHUMG00000150913

Related Products :

C099 Recombinant Human Oncostatin M, OSM (N-6His) 50 µg 496 € novo human
RP-1432M Recombinant Mouse Oncostatin M / OSM Protein (His Tag) 20μg 572 € adv mouse
abx574573 Anti-Human Oncostatin M (OSM) ELISA Kit inquire 50 € abbex human
BB-EK0478 anti-Human OSM/Oncostatin M ELISA Kit Antibody 96 Tests 717 € acr human
AE29110HU-48 ELISA test for Human Oncostatin-M (OSM) 1x plate of 48 wells 297 € abebio human
AE29110HU Human Oncostatin-M (OSM) ELISA Kit 48 wells plate 389 € ab-elisa elisas human
AE29110HU-96 Human Oncostatin-M (OSM) ELISA Kit 1x plate of 96 wells 461 € abebio human
DL-OSM-Hu Human Oncostatin M OSM ELISA Kit 96T 846 € DL elisas human
MBS248085 PAb (IgG) to Human OSM / Oncostatin M Antibody 50ug 597 € MBS Polyclonals_1 human
abx576024 Anti-Cow Oncostatin M (OSM) ELISA Kit inquire 50 € abbex cow
abx574574 Anti-Mouse Oncostatin M (OSM) ELISA Kit 96 tests 746 € abbex mouse
GENTAUR-58bdc6f0629bd Anti- Oncostatin M (OSM) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdc6f0beaa3 Anti- Oncostatin M (OSM) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdc7fa93317 Anti- Oncostatin M (OSM) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdc7fae871a Anti- Oncostatin M (OSM) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdd1c97c323 Anti- Oncostatin M (OSM) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdd1f049578 Anti- Oncostatin M (OSM) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdd4dc4a7fc Anti- Oncostatin M (OSM) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdd8c790404 Anti- Oncostatin M (OSM) Antibody 100ug 531 € MBS Polyclonals human
abx574661 Anti-Rat Oncostatin M (OSM) ELISA Kit 96 tests 775 € abbex rat
DL-OSM-b Bovine Oncostatin M OSM ELISA Kit 96T 962 € DL elisas bovine
AE29109RB-48 ELISA test for Rabbit Oncostatin-M (OSM) 1x plate of 48 wells 402 € abebio human
DL-OSM-Mu Mouse Oncostatin M OSM ELISA Kit 96T 869 € DL elisas mouse
R31961 Oncostatin M Antibody / OSM 0.1mg 406 € NJS poly human
EKU06390 Oncostatin M (OSM) ELISA kit 1 plate of 96 wells 745 € Biomatik ELISA kits human
EKU06391 Oncostatin M (OSM) ELISA kit 1 plate of 96 wells 764 € Biomatik ELISA kits human
EKU06392 Oncostatin M (OSM) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
AE29109RB Rabbit Oncostatin-M (OSM) ELISA Kit 48 wells plate 515 € ab-elisa elisas human
AE29109RB-96 Rabbit Oncostatin-M (OSM) ELISA Kit 1x plate of 96 wells 671 € abebio human
DL-OSM-Ra Rat Oncostatin M OSM ELISA Kit 96T 904 € DL elisas rat