| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Oncostatin M is produced by our E, coli expression system and the target gene encoding Ala26-Arg221 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
24, 44 kD |
| UniProt number: |
P13725 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
OSM (N-6His), Oncostatin M |
| Short name: |
OSM (N-6His), Recombinant Oncostatin M |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
oncostatin M (N-6His), sapiens Oncostatin M, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BT, Extracellular, OSM and IDBG-4002 and ENSG00000099985 and 5008, Osm and IDBG-142284 and ENSMUSG00000058755 and 18413, growth factor activity, this GO :0002675 and positive regulation of acute inflammatory response and biological process this GO :0005125 and cytokine activity and molecular function this GO :0005147 and oncostatin-M receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005900 and oncostatin-M receptor complex and cellular component this GO :0006955 and immune response and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0007422 and peripheral nervous system development and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008283 and cell proliferation and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008285 and negative regulation of cell proliferation and biological process this GO :0009408 and response to heat and biological process this GO :0033138 and positive regulation of peptidyl-serine phosphorylation and biological process this GO :0040008 and regulation of growth and biological process this GO :0042503 and tyrosine phosphorylation of Stat3 protein and biological process this GO :0042506 and tyrosine phosphorylation of Stat5 protein and biological process this GO :0042508 and tyrosine phosphorylation of Stat1 protein and biological process this GO :0043410 and positive regulation of MAPK cascade and biological process this GO :0045835 and negative regulation of meiosis and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046888 and negative regulation of hormone secretion and biological process this GO :0048266 and behavioral response to pain and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0051781 and positive regulation of cell division and biological process this GO :2001235 and positive regulation of apoptotic signaling pathway and biological process, this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity and also this GO :0005147 : oncostatin-M receptor binding and also this GO :0008083 : growth factor activity, this GO :0005147 : oncostatin-M receptor binding, this GO :0008083 : growth factor activity, 45038 and IDBG-636338 and ENSBTAG00000016163 and 319086, oncostatin M |
| Identity: |
8506 |
| Gene: |
OSM |
More about : OSM |
| Long gene name: |
oncostatin M |
| Synonyms: |
MGC20461 |
| Locus: |
22q12, 2 |
| Discovery year: |
1992-07-09 |
| GenBank acession: |
AF129855 |
| Entrez gene record: |
5008 |
| Pubmed identfication: |
1717982 |
| RefSeq identity: |
NM_020530 |
| Classification: |
Interleukin 6 cytokine family |
| Havana BLAST/BLAT: |
OTTHUMG00000150913 |