Recombinant Mouse Complement Component C5

Contact us
Catalog number: C075
Price: 624 €
Supplier: adv
Product name: Recombinant Mouse Complement Component C5
Quantity: 10μg
Other quantities: 1 mg 2283€ 10 µg 187€ 50 µg 456€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Complement Component C5 is produced by our E, coli expression system and the target gene encoding Asn679-Arg755 is expressed
Molecular Weight: 9 kD
UniProt number: P06684
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 350 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 5, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MNLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: Complement Component C5
Short name: Recombinant Mouse Complement Component C5
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: recombinant Mouse Complement Component complement component 5
Alternative technique: rec
Alternative to gene target: BT, C5 and IDBG-83167 and ENSG00000106804 and 727, C5a anaphylatoxin chemotactic receptor binding, C5a and C5b and C5D and CPAMD4 and ECLZB, Extracellular, Hc and IDBG-163835 and ENSMUSG00000026874 and 15139, alternative pathway and biological process this GO :0006958 and complement activation, classical pathway and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0008009 and chemokine activity and molecular function this GO :0010575 and positive regulation vascular endothelial growth factor production and biological process this GO :0010700 and negative regulation of norepinephrine secretion and biological process this GO :0010760 and negative regulation of macrophage chemotaxis and biological process this GO :0010951 and negative regulation of endopeptidase activity and biological process this GO :0019835 and cytolysis and biological process this GO :0030449 and regulation of complement activation and biological process this GO :0031714 and C5a anaphylatoxin chemotactic receptor binding and molecular function this GO :0033602 and negative regulation of dopamine secretion and biological process this GO :0042593 and glucose homeostasis and biological process this GO :0045087 and innate immune response and biological process this GO :0045766 and positive regulation of angiogenesis and biological process this GO :0050921 and positive regulation of chemotaxis and biological process this GO :0060326 and cell chemotaxis and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0090197 and positive regulation of chemokine secretion and biological process, this GO :0000187 and activation of MAPK activity and biological process this GO :0001701 and in utero embryonic development and biological process this GO :0002523 and leukocyte migration involved in inflammatory response and biological process this GO :0004866 and endopeptidase inhibitor activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005579 and membrane attack complex and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006874 and cellular calcium ion homeostasis and biological process this GO :0006935 and chemotaxis and biological process this GO :0006950 and response to stress and biological process this GO :0006954 and inflammatory response and biological process this GO :0006956 and complement activation and biological process this GO :0006957 and complement activation, this GO :0004866 : endopeptidase inhibitor activity, this GO :0004866 : endopeptidase inhibitor activity and also this GO :0005102 : receptor binding and also this GO :0005515 : protein binding and also this GO :0008009 : chemokine activity and also this GO :0031714 : C5a anaphylatoxin chemotactic receptor binding, this GO :0005102 : receptor binding, this GO :0005515 : protein binding, this GO :0008009 : chemokine activity, this GO :0031714 : C5a anaphylatoxin chemotactic receptor binding, 24055 and IDBG-638834 and ENSBTAG00000012210 and 512045, complement component 5
Identity: 1331
Gene: C5 | More about : C5
Long gene name: complement C5
Synonyms gene name: complement component 5
Synonyms: CPAMD4 C5a C5b
Synonyms name: prepro-C5 C5a anaphylatoxin
Locus: 9q33, 2
Discovery year: 2001-06-22
GenBank acession: M57729
Entrez gene record: 727
RefSeq identity: NM_001735
Classification: Endogenous ligands Complement system C3 and PZP like, alpha-2-macroglobulin domain containing
Havana BLAST/BLAT: OTTHUMG00000020579
Locus Specific Databases: C5base: Mutation registry for C5 deficiency LRG_28

Related Products :

abx166851 Anti-Complement Complement C4b Protein (Recombinant) 100 μg 847 € abbex human
CM99 Recombinant Mouse Complement Component C3a, C3a 10 µg 156 € novo mouse
C075 Recombinant Mouse Complement Component C5 500 µg 1613 € novo mouse
abx153738 Anti-Mouse Complement Complement C4a ELISA Kit 96 tests 876 € abbex mouse
AXL900M C5b-9 Complement, Terminal Complement Complex (TCC), Clone: aE11, Mouse Monoclonal antibody-Human; frozen/NO paraffin, IH/ELISA/WB 1000ul 1392 € accurate-monoclonals human
MBS623305 Pyruvate Dehydrogenase Complex Component X (Pyruvate Dehydrogenase Complex Lipoyl-containing Component X, Pyruvate Dehydrogenase Protein X Component Mitochondrial, PDHX, Dihydrolipoamide Dehydrogenase Binding Protein of Pyruvate Dehydrogenase Complex, DLD 100ug 735 € MBS Polyclonals_1 human
ACL7501B C1q Complement Component; Clone: RmC7H8, Rat Mouse Monoclonal antibody-Mouse; Biotin 0.1mg 233 € accurate-monoclonals mouse
ACL7611APC Complement Component C1q, Rat Mouse Monoclonal antibody-Mouse; Clone: MhC5B9, APC conj. 0.1mg 414 € accurate-monoclonals mouse
ACL7503APC Complement Component C3, Rat Mouse Monoclonal antibody-Mouse; Clone: RmC11H9, APC conj. 0.1mg 401 € accurate-monoclonals mouse
abx261436 Anti-Complement Component 1 Protein (Recombinant) 25 µg 340 € abbex human
abx167146 Anti-Complement Component 1, Q Receptor Protein (Recombinant) 10 μg 427 € abbex human
abx167458 Anti-Complement Component 1, Q Receptor Protein (Recombinant) 50 μg 630 € abbex human
abx168542 Anti-Complement Component 1, Q Receptor Protein (Recombinant) 50 μg 644 € abbex human
abx166435 Anti-Complement Component 1, Q Subcomponent A Protein (Recombinant) 50 μg 528 € abbex human
abx167222 Anti-Complement Component 1, Q Subcomponent A Protein (Recombinant) 100 μg 818 € abbex human
abx168491 Anti-Complement Component 1, Q Subcomponent A Protein (Recombinant) 50 μg 615 € abbex human
abx166955 Anti-Complement Component 1, S Subcomponent Protein (Recombinant) 50 μg 615 € abbex human
abx260927 Anti-Complement Component 4 Binding Protein, beta Protein (Recombinant) 25 µg 340 € abbex human
abx166491 Anti-Complement Component 6 Protein (Recombinant) 100 μg 804 € abbex human
abx167130 Anti-Complement Component 7 Protein (Recombinant) 10 μg 412 € abbex human
abx167779 Anti-Complement Component 7 Protein (Recombinant) 10 μg 427 € abbex human
abx261505 Anti-Complement Component 8, gamma Protein (Recombinant) 1 mg 3559 € abbex human
abx167798 Anti-Complement Component 8b Protein (Recombinant) 10 μg 441 € abbex human
abx167151 Anti-Complement Component 8g Protein (Recombinant) 50 μg 644 € abbex human
abx166504 Anti-Complement Component 9 Protein (Recombinant) 100 μg 804 € abbex human
abx167331 Anti-Complement Component 9 Protein (Recombinant) 100 μg 862 € abbex human
abx167559 Anti-Complement Component 9 Protein (Recombinant) 100 μg 963 € abbex human
abx262470 Anti-Complement Component C5a Protein (Recombinant) 10 µg 340 € abbex human
RP-0164H Recombinant Human C2 / Complement Component 2 Protein (Fc Tag) 10μg 624 € adv human
RP-0163H Recombinant Human C2 / Complement Component 2 Protein (His Tag) 10μg 624 € adv human