| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Complement Component C5 is produced by our E, coli expression system and the target gene encoding Asn679-Arg755 is expressed |
| Molecular Weight: |
9 kD |
| UniProt number: |
P06684 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
350 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, 5, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MNLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
Complement Component C5 |
| Short name: |
Recombinant Mouse Complement Component C5 |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
recombinant Mouse Complement Component complement component 5 |
| Alternative technique: |
rec |
| Alternative to gene target: |
BT, C5 and IDBG-83167 and ENSG00000106804 and 727, C5a anaphylatoxin chemotactic receptor binding, C5a and C5b and C5D and CPAMD4 and ECLZB, Extracellular, Hc and IDBG-163835 and ENSMUSG00000026874 and 15139, alternative pathway and biological process this GO :0006958 and complement activation, classical pathway and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007186 and G-protein coupled receptor signaling pathway and biological process this GO :0008009 and chemokine activity and molecular function this GO :0010575 and positive regulation vascular endothelial growth factor production and biological process this GO :0010700 and negative regulation of norepinephrine secretion and biological process this GO :0010760 and negative regulation of macrophage chemotaxis and biological process this GO :0010951 and negative regulation of endopeptidase activity and biological process this GO :0019835 and cytolysis and biological process this GO :0030449 and regulation of complement activation and biological process this GO :0031714 and C5a anaphylatoxin chemotactic receptor binding and molecular function this GO :0033602 and negative regulation of dopamine secretion and biological process this GO :0042593 and glucose homeostasis and biological process this GO :0045087 and innate immune response and biological process this GO :0045766 and positive regulation of angiogenesis and biological process this GO :0050921 and positive regulation of chemotaxis and biological process this GO :0060326 and cell chemotaxis and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0090197 and positive regulation of chemokine secretion and biological process, this GO :0000187 and activation of MAPK activity and biological process this GO :0001701 and in utero embryonic development and biological process this GO :0002523 and leukocyte migration involved in inflammatory response and biological process this GO :0004866 and endopeptidase inhibitor activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005579 and membrane attack complex and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006874 and cellular calcium ion homeostasis and biological process this GO :0006935 and chemotaxis and biological process this GO :0006950 and response to stress and biological process this GO :0006954 and inflammatory response and biological process this GO :0006956 and complement activation and biological process this GO :0006957 and complement activation, this GO :0004866 : endopeptidase inhibitor activity, this GO :0004866 : endopeptidase inhibitor activity and also this GO :0005102 : receptor binding and also this GO :0005515 : protein binding and also this GO :0008009 : chemokine activity and also this GO :0031714 : C5a anaphylatoxin chemotactic receptor binding, this GO :0005102 : receptor binding, this GO :0005515 : protein binding, this GO :0008009 : chemokine activity, this GO :0031714 : C5a anaphylatoxin chemotactic receptor binding, 24055 and IDBG-638834 and ENSBTAG00000012210 and 512045, complement component 5 |
| Identity: |
1331 |
| Gene: |
C5 |
More about : C5 |
| Long gene name: |
complement C5 |
| Synonyms gene name: |
complement component 5 |
| Synonyms: |
CPAMD4 C5a C5b |
| Synonyms name: |
prepro-C5 C5a anaphylatoxin |
| Locus: |
9q33, 2 |
| Discovery year: |
2001-06-22 |
| GenBank acession: |
M57729 |
| Entrez gene record: |
727 |
| RefSeq identity: |
NM_001735 |
| Classification: |
Endogenous ligands Complement system C3 and PZP like, alpha-2-macroglobulin domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000020579 |
| Locus Specific Databases: |
C5base: Mutation registry for C5 deficiency LRG_28 |