Recombinant Mouse Fibroblast Growth Factor 2, FGF-2, FGFb (Met1-Ser154)

Contact us
Catalog number: C044
Price: 1613 €
Supplier: novo
Product name: Recombinant Mouse Fibroblast Growth Factor 2, FGF-2, FGFb (Met1-Ser154)
Quantity: 500 µg
Other quantities: 50 µg 192€ 500 µg 674€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Fibroblast growth factor 2 is produced by our E, coli expression system and the target gene encoding Met1-Ser154 is expressed
Molecular Weight: 15 kD, 17
UniProt number: P15655
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 400 mM sodium chloride, pH 7, 2 um filtered solution of 20 mM PB, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: FGF-2, FGFb (Met1-Ser154), Fibroblast Growth Factor 2
Short name: FGF-2, FGFb (Met1-Ser154), Recombinant Mouse Fibroblast Growth Factor 2
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: FGF-2, FGFb (Met1-Ser154), recombinant Mouse Fibroblast Growth Factor 2
Alternative technique: rec

Related Products :

C044 Recombinant Mouse Fibroblast Growth Factor 2, FGF-2, FGFb (Met1-Ser154) 1 mg 943 € novo mouse
MBS624298 Fibroblast Growth Factor, Basic (FGF Basic, FGFb, BFGF, Fibroblast Growth Factor 2, FGF2, Heparin-binding Growth Factor 2, HBGF-2, Prostatropin) (Biotin) Antibody 50ug 763 € MBS Polyclonals_1 human
MBS623388 Fibroblast Growth Factor, Basic (FGFb, BFGF, Fibroblast Growth Factor 2, FGF2, Heparin-binding Growth Factor 2, HBGF-2) Antibody 100ug 652 € MBS Polyclonals_1 human
MBS624013 Fibroblast Growth Factor, Basic (FGFb, BFGF, Fibroblast Growth Factor 2, FGF2, Heparin-binding Growth Factor 2, HBGF-2) Antibody 100ul 696 € MBS Polyclonals_1 human
MBS624077 Fibroblast Growth Factor, Acidic (FGF Acidic, FGFa, aFGF, FGF alpha, Fibroblast Growth Factor 1, FGF1, AFGF, Beta Endothelial Cell Growth Factor alpha, ECGFA, Endothelial Cell Growth Factor beta, ECGF-beta, ECGFB, ECGF, GLIO703, Heparin-binding Growth Fac Antibody 100ug 531 € MBS Polyclonals_1 human
C046 Recombinant Human Fibroblast Growth Factor 2, FGF-2, FGFb (Gly132-Ser288) 10 µg 100 € novo human
C751 Recombinant Human Fibroblast Growth Factor 2, FGF-2, FGFb (Met134-Ser288) 1 mg 2283 € novo human
C779 Recombinant Human Fibroblast Growth Factor 2, FGF-2, FGFb (Pro143-Ser288) 500 µg 1613 € novo human
CM25 Recombinant Rat Fibroblast Growth Factor 2, FGF2, FGFb 500 µg 1613 € novo rat
OBT4849 Fibroblast Growth Factor Basic (FGFb), Not suitable for detecting bFGF bound to cell surface receptors, Clone: MC-GF1, Mouse Monoclonal antibody-Human; frozen, IH/ELISA 0.5 mg Ask price € accurate-monoclonals human
GWB-8D4EB8 antibody to or anti- Fibroblast Growth Factor-Basic (FGFb) antibody 1 vial 521 € genways human
MBS623379 Fibroblast Growth Factor, Basic (FGFb) Antibody 50ug 426 € MBS Polyclonals_1 human
MBS611950 Nerve Growth Factor, beta (NGF, Beta Nerve Growth Factor, Beta Nerve Growth Factor Precursor, Beta NGF, HSAN5, Nerve Growth Factor beta, Nerve Growth Factor beta Polypeptide, Nerve Growth Factor beta Subunit, NGFB) 500ug 652 € MBS Polyclonals_1 human
MBS624653 Keratinocyte Growth Factor (KGF, Fibroblast Growth Factor 7, FGF-7) Antibody 100ug 464 € MBS Polyclonals_1 human
MBS623813 Fibroblast Growth Factor, Acidic (FGFa, aFGF, Fibroblast Growth Factor 1, FGF1, AFGF, ECGF, ECGF-beta, ECGFB, GLIO703, HBGF1) Antibody 100ul 1277 € MBS Polyclonals_1 human
C798 Recombinant Human, Mouse Fibroblast Growth Factor 8B, FGF-8B 50 µg 369 € novo mouse
C043 Recombinant Mouse Fibroblast Growth Factor 1, FGF-1, FGFa (Phe16-Asp155) 500 µg 674 € novo mouse
CR04 Recombinant Mouse Fibroblast Growth Factor 17, FGF-17 (C-6His) 500 µg 1613 € novo mouse
CR12 Recombinant Mouse Fibroblast Growth Factor 9, FGF-9(C-6His) 1 mg 1877 € novo mouse
CH84 Recombinant Human Pro-Neuregulin-1, NRG1‑β1, HRG1‑β1 (Met1-Lys246, N-6His) 500 µg 709 € novo human
GWB-D02951 Fibroblast Growth Factor-Basic human recombinant (rHu FGF-b)) 1 vial 3432 € genways human
GWB-AC2BB5 Fibroblast Growth Factor (FGF-4) recombinant 1 vial 579 € genways human
CS24 Recombinant Cynomolgus Fibroblast Growth Factor 21, FGF-21 (C-6His) 50 µg 369 € novo human
CH53 Recombinant Human Fibroblast Growth Factor 1, FGF-1, FGFa (Ala2-Asp155) 500 µg 1613 € novo human
C049 Recombinant Human Fibroblast Growth Factor 1, FGF-1, FGFa (Phe16-Asp155) 10 µg 100 € novo human
C222 Recombinant Human Fibroblast Growth Factor 12, FGF-12 500 µg 1613 € novo human
CG42 Recombinant Human Fibroblast Growth Factor 17, FGF-17 500 µg 1613 € novo human
C996 Recombinant Human Fibroblast Growth Factor 17, FGF-17 (C-6His) 1 mg 2283 € novo human
CG74 Recombinant Human Fibroblast Growth Factor 19, FGF-19 (N-6His) 1 mg 2283 € novo human
C223 Recombinant Human Fibroblast Growth Factor 21, FGF-21 (N-6His) 500 µg 1613 € novo human