Recombinant Human Fibroblast Growth Factor 12, FGF-12

Contact us
Catalog number: C222
Price: 579 €
Supplier: genways
Product name: Recombinant Human Fibroblast Growth Factor 12, FGF-12
Quantity: 1 vial
Other quantities: 1 mg 2283€ 10 µg 131€ 50 µg 273€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Fibroblast Growth Factor 12 is produced by our E, coli expression system and the target gene encoding Met1-Thr181 is expressed
Molecular Weight: 20, 45 kD
UniProt number: P61328
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 5 mM EDTA, pH 7, 2 um filtered solution of 20 mM PB, 5, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREQSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: FGF-12, Fibroblast Growth Factor 12
Short name: FGF-12, Recombinant Fibroblast Growth Factor 12
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: FGF-12, sapiens Fibroblast Growth Factor 12, recombinant H
Alternative technique: rec

Related Products :

MBS624077 Fibroblast Growth Factor, Acidic (FGF Acidic, FGFa, aFGF, FGF alpha, Fibroblast Growth Factor 1, FGF1, AFGF, Beta Endothelial Cell Growth Factor alpha, ECGFA, Endothelial Cell Growth Factor beta, ECGF-beta, ECGFB, ECGF, GLIO703, Heparin-binding Growth Fac Antibody 100ug 531 € MBS Polyclonals_1 human
MBS624298 Fibroblast Growth Factor, Basic (FGF Basic, FGFb, BFGF, Fibroblast Growth Factor 2, FGF2, Heparin-binding Growth Factor 2, HBGF-2, Prostatropin) (Biotin) Antibody 50ug 763 € MBS Polyclonals_1 human
MBS623388 Fibroblast Growth Factor, Basic (FGFb, BFGF, Fibroblast Growth Factor 2, FGF2, Heparin-binding Growth Factor 2, HBGF-2) Antibody 100ug 652 € MBS Polyclonals_1 human
MBS624013 Fibroblast Growth Factor, Basic (FGFb, BFGF, Fibroblast Growth Factor 2, FGF2, Heparin-binding Growth Factor 2, HBGF-2) Antibody 100ul 696 € MBS Polyclonals_1 human
MBS611950 Nerve Growth Factor, beta (NGF, Beta Nerve Growth Factor, Beta Nerve Growth Factor Precursor, Beta NGF, HSAN5, Nerve Growth Factor beta, Nerve Growth Factor beta Polypeptide, Nerve Growth Factor beta Subunit, NGFB) 500ug 652 € MBS Polyclonals_1 human
MBS624653 Keratinocyte Growth Factor (KGF, Fibroblast Growth Factor 7, FGF-7) Antibody 100ug 464 € MBS Polyclonals_1 human
MBS623813 Fibroblast Growth Factor, Acidic (FGFa, aFGF, Fibroblast Growth Factor 1, FGF1, AFGF, ECGF, ECGF-beta, ECGFB, GLIO703, HBGF1) Antibody 100ul 1277 € MBS Polyclonals_1 human
GWB-D02951 Fibroblast Growth Factor-Basic human recombinant (rHu FGF-b)) 1 vial 3432 € genways human
CH53 Recombinant Human Fibroblast Growth Factor 1, FGF-1, FGFa (Ala2-Asp155) 500 µg 1613 € novo human
C049 Recombinant Human Fibroblast Growth Factor 1, FGF-1, FGFa (Phe16-Asp155) 10 µg 100 € novo human
C222 Recombinant Human Fibroblast Growth Factor 12, FGF-12 500 µg 1613 € novo human
CG42 Recombinant Human Fibroblast Growth Factor 17, FGF-17 500 µg 1613 € novo human
C996 Recombinant Human Fibroblast Growth Factor 17, FGF-17 (C-6His) 1 mg 2283 € novo human
CG74 Recombinant Human Fibroblast Growth Factor 19, FGF-19 (N-6His) 1 mg 2283 € novo human
C046 Recombinant Human Fibroblast Growth Factor 2, FGF-2, FGFb (Gly132-Ser288) 10 µg 100 € novo human
C751 Recombinant Human Fibroblast Growth Factor 2, FGF-2, FGFb (Met134-Ser288) 1 mg 2283 € novo human
C779 Recombinant Human Fibroblast Growth Factor 2, FGF-2, FGFb (Pro143-Ser288) 500 µg 1613 € novo human
C223 Recombinant Human Fibroblast Growth Factor 21, FGF-21 (N-6His) 500 µg 1613 € novo human
CA19 Recombinant Human Fibroblast Growth Factor 23, FGF-23 (C-6His) 10 µg 202 € novo human
CR08 Recombinant Human Fibroblast Growth Factor 4, FGF-4 50 µg 369 € novo human
C806 Recombinant Human Fibroblast Growth Factor 6, FGF-6 50 µg 369 € novo human
CH73 Recombinant Human Fibroblast Growth Factor 7, FGF-7, KGF 10 µg 202 € novo human
CM88 Recombinant Human Fibroblast Growth Factor 7, FGF-7, KGF (C-6His) 10 µg 202 € novo human
CK13 Recombinant Human Fibroblast Growth Factor 8, FGF-8a (N-6His) 10 µg 141 € novo human
CK14 Recombinant Human Fibroblast Growth Factor 8, FGF-8e (N-6His) 50 µg 369 € novo human
CK12 Recombinant Human Fibroblast Growth Factor 8, FGF-8F (N-6His) 10 µg 156 € novo human
C198 Recombinant Human Fibroblast Growth Factor 9, FGF-9 1 mg 1836 € novo human
CB43 Recombinant Human Fibroblast Growth Factor Receptor 3, FGF R3 (C-Fc) 1 mg 1572 € novo human
C798 Recombinant Human, Mouse Fibroblast Growth Factor 8B, FGF-8B 50 µg 369 € novo mouse
GWB-AC2BB5 Fibroblast Growth Factor (FGF-4) recombinant 1 vial 579 € genways human