Recombinant Mouse S100A4 (C-6His)

Contact us
Catalog number: CR30
Price: 431 €
Supplier: MBS Polyclonals
Product name: Recombinant Mouse S100A4 (C-6His)
Quantity: 50ug
Other quantities: 10 µg 126€ 50 µg 278€ 500 µg 963€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse S100A4 is produced by our E, coli expression system and the target gene encoding Met1-Lys101 is expressed with a 6His at the C-terminus
Molecular Weight: 12, 5 kD
UniProt number: P07091
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, -20°, Aliquots of reconstituted samples are stable at <, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 6 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKKHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: S100A4 (C-6His)
Short name: Recombinant Mouse S100A4 (C-6His)
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: recombinant Mouse S100A4 (C-6His)
Alternative technique: rec
Identity: 10494
Gene: S100A4 | More about : S100A4
Long gene name: S100 calcium binding protein A4
Synonyms gene: MTS1 CAPL
Synonyms gene name: S100 calcium-binding protein A4 (calcium protein, calvasculin, calvasculin, metastasin, metastasin, murine placental homolog) , murine placental homolog) S100 calcium binding protein A4 (calcium protein
Synonyms: P9KA 18A2 PEL98 42A FSP1
Synonyms name: fibroblast-specific protein-1
Locus: 1q21, 3
Discovery year: 1989-06-30
GenBank acession: BC016300
Entrez gene record: 6275
Pubmed identfication: 3155863
RefSeq identity: NM_002961
Classification: S100 calcium binding proteins EF-hand domain containing
Havana BLAST/BLAT: OTTHUMG00000013546

Related Products :

CR30 Recombinant Mouse S100A4 (C-6His) 1 mg 1318 € novo mouse
CR29 Recombinant Human S100A4 (C-6His) 10 µg 126 € novo human
RP-1484M Recombinant Mouse S100A4 Protein 50μg 624 € adv mouse
RP-1485M Recombinant Mouse S100A4 Protein (Fc Tag) 50μg 624 € adv mouse
GWB-27E24E Recombinant Human S100A4 His Tag bulk Ask price € genways bulk human
RP-1350H Recombinant Human S100A4 Protein (Fc Tag) 50μg 624 € adv human
RP-1349H Recombinant Human S100A4 Protein (His Tag) 50μg 624 € adv human
GWB-P1718B S100A4, 1-101 aa, Recombinant Protein bulk Ask price € genways bulk human
GWB-P0958I S100A4, 1-101aa, Recombinant Protein bulk Ask price € genways bulk human
abx154629 Anti-Mouse S100A4 ELISA Kit 96 tests 949 € abbex mouse
abx575700 Anti-Mouse S100A4 ELISA Kit 96 tests 804 € abbex mouse
DL-S100A4-Mu Mouse S100 Calcium Binding Protein A4 S100A4 ELISA Kit 96T 921 € DL elisas mouse
abx153001 Anti-Human S100A4 ELISA Kit 96 tests 934 € abbex human
abx576463 Anti-Human S100A4 ELISA Kit 96 tests 789 € abbex human
MBS242231 Anti-Human S100A4 / FSP1 0.25 ml 597 € MBS Polyclonals_1 human
MBS300748 Anti-Human S100A4 PAb 7 ml (RTU) 304 € MBS Polyclonals_1 human
MBS300749 Anti-Human S100A4 PAb 1 mililiter 531 € MBS Polyclonals_1 human
MBS301562 Anti-Human S100A4 PAb 100ul 227 € MBS Polyclonals_1 human
MBS302461 Anti-Human S100A4 PAb 500ul 370 € MBS Polyclonals_1 human
abx156059 Anti-Rat S100A4 ELISA Kit 96 tests 992 € abbex rat
abx576209 Anti-Rat S100A4 ELISA Kit inquire 50 € abbex rat
GENTAUR-58bdc119e0b9f Anti- S100 Calcium Binding Protein A4 (S100A4) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdc48ae4ee9 Anti- S100 Calcium Binding Protein A4 (S100A4) Antibody 100ug 608 € MBS Polyclonals human
GENTAUR-58bdc6691cd33 Anti- S100 Calcium Binding Protein A4 (S100A4) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdc66985711 Anti- S100 Calcium Binding Protein A4 (S100A4) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdca5df1f4f Anti- S100 Calcium Binding Protein A4 (S100A4) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdca5e76cad Anti- S100 Calcium Binding Protein A4 (S100A4) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdd05fa734a Anti- S100 Calcium Binding Protein A4 (S100A4) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdd0a917d79 Anti- S100 Calcium Binding Protein A4 (S100A4) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd0a979c73 Anti- S100 Calcium Binding Protein A4 (S100A4) Antibody 50ug 431 € MBS Polyclonals human