| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
X Isoform is produced by our Yeast expression system and the target gene encoding Met17-Asp191 is expressed with a 6His tag at the N-terminus, Recombinant Human Amelogenin |
| Molecular Weight: |
1 kD, 22 |
| UniProt number: |
Q99217 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGHHHHHHGSGSLEVLFQGPMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
AMELX (N-6His), Amelogenin |
| Short name: |
AMELX (N-6His), Recombinant Amelogenin |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
X-linked (N-6His), amelogenin, sapiens Amelogenin, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
AI1E and AIH1 and ALGN and AMG and AMGL and AMGX, AMELX and IDBG-43792 and ENSG00000125363 and 265, Extracellular, X-linked, hydroxyapatite binding, this GO :0001649 and osteoblast differentiation and biological process this GO :0001837 and epithelial to mesenchymal transition and biological process this GO :0002062 and chondrocyte differentiation and biological process this GO :0005515 and protein binding and molecular function this GO :0005578 and proteinaceous extracellular matrix and cellular component this GO :0007155 and cell adhesion and biological process this GO :0007165 and signal transduction and biological process this GO :0007275 and multicellular organismal development and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008283 and cell proliferation and biological process this GO :0009986 and cell surface and cellular component this GO :0030345 and structural constituent of tooth enamel and molecular function this GO :0031214 and biomineral tissue development and biological process this GO :0032967 and positive regulation of collagen biosynthetic process and biological process this GO :0034505 and tooth mineralization and biological process this GO :0042475 and odontogenesis of dentin-containing tooth and biological process this GO :0042802 and identical protein binding and molecular function this GO :0046848 and hydroxyapatite binding and molecular function this GO :0050801 and ion homeostasis and biological process this GO :0070166 and enamel mineralization and biological process this GO :0070172 and positive regulation of tooth mineralization and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity and also this GO :0030345 : structural constituent of tooth enamel and also this GO :0042802 : identical protein binding and also this GO :0046848 : hydroxyapatite binding, this GO :0008083 : growth factor activity, this GO :0030345 : structural constituent of tooth enamel, this GO :0042802 : identical protein binding, this GO :0046848 : hydroxyapatite binding, amelogenin |
| Identity: |
461 |
| Gene: |
AMELX |
More about : AMELX |
| Long gene name: |
X-linked , amelogenin |
| Synonyms gene: |
AMG AIH1 |
| Synonyms gene name: |
amelogenesis imperfecta 1) , amelogenin (X chromosome |
| Synonyms name: |
amelogenesis imperfecta 1 |
| Locus: |
Xp22, 2 |
| Discovery year: |
1988-05-11 |
| Entrez gene record: |
265 |
| Pubmed identfication: |
1734713 |
| RefSeq identity: |
NM_001142 |
| Havana BLAST/BLAT: |
OTTHUMG00000021130 |
| Locus Specific Databases: |
Mental Retardation database |