Recombinant Cynomolgus Tumor Necrosis Factor Ligand 2B, OX40L(N-8His)

Contact us
Catalog number: CP72
Price: 50 €
Supplier: abbex
Product name: Recombinant Cynomolgus Tumor Necrosis Factor Ligand 2B, OX40L(N-8His)
Quantity: inquire
Other quantities: 1 mg 3602€ 10 µg 232€ 500 µg 2536€
Related search:

More details :

Reacts with: Cynomolgus monkey
Source: proteins, Recombinants or rec
Description: Receptor agonists are often tested for drug development, FAS ligand and other ligands are binding to the receptor for signaling pathways for example in apoptosis or JNK signaling
Molecular Weight: 16, 5 kD
UniProt number: F7FL80
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: HHHHHHHHQVSHQYPRIQSIKVQFTEYKKEEGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Group: recombinants
Gene target: OX40L(N-8His), Cynomolgus Tumor Necrosis Factor Ligand 2B
Short name: OX40L(N-8His), Recombinant Cynomolgus Tumor Necrosis Factor Ligand 2B
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Alternative name: OX40L(N-8His), recombinant Cynomolgus Tumor Necrosis Factor Ligand 2B
Alternative technique: rec

Related Products :

CP72 Recombinant Cynomolgus Tumor Necrosis Factor Ligand 2B, OX40L(N-8His) 500 µg 2536 € novo human
MBS617120 Tumor Necrosis Factor Receptor 1, p55/p60 (TNFR 1, CD120a, MGC19588, p55, p55 R, TNFR55, Tumor Necrosis Factor alpha Receptor, Tumor Necrosis Factor Binding Protein 1, TBP1, Tumor Necrosis Factor Receptor Superfamily Member 1A, TNFRSF1a) 100ug 868 € MBS Polyclonals_1 human
CM74 Recombinant Mouse OX40 Ligand, TNFSF4, OX40L (N-8His) 50 µg 369 € novo mouse
MBS611323 TWEAK (TNF-related Weak Inducer of Apoptosis, APO3 Ligand, APO3/DR3 Ligand, APO3L, CD255, DR3LG, FN14, HCG1991317, MGC129581, MGC20669, Tumor Necrosis Factor Ligand Superfamily Member 12, TNFSF12, UNQ181/PRO207) Antibody 50ug 426 € MBS Polyclonals_1 human
MBS621645 DR6 (Death Receptor 6, BM018, MGC31965, TNFR Related Death Receptor 6, Tumor Necrosis Factor Receptor Superfamily Member 21, Tumor Necrosis Factor Receptor Superfamily Member 21 Precursor, TNFRSF21) Antibody 100ug 564 € MBS Polyclonals_1 human
MBS620184 TNF Receptor, Extracellular Domain p55 (TNFR 1, CD120a, MGC19588, p55, p55 R, TNFR55, Tumor Necrosis Factor alpha Receptor, Tumor Necrosis Factor Binding Protein 1, TBP1, Tumor Necrosis Factor Receptor Superfamily Member 1A, TNFRSF1a) Antibody 1000ug 685 € MBS Polyclonals_1 human
MBS619623 Tumor Necrosis Factor Receptor 1, p55/p60 (TNFR 1, TNFR1, TNF-R1, TNF-R, Tumor Necrosis Factor Receptor Type I, TNFR-I, TNF-RI, TNF-R-I, CD120a, FPF, MGC19588, p55, p55-R, p60, TBP1, TNFR55, TNF-R55, TNFR60, Tumor Necrosis Factor alpha Receptor, TNFAR, Tu Antibody 100ug 652 € MBS Polyclonals_1 human
MBS624468 Tumor Necrosis Factor Receptor 2, p75/p80 (TNFR 2, Tnfr2, Tnfr-2, TNF-R2, Tumor Necrosis Factor Receptor Type II, TNFRII, TNFR-II, TNF-RII, TNF-R-II, CD120b, p75, p80 TNF alpha Receptor, TNF-R75, TNFR80, TNFalpha-R2, TNF-alphaR2, Tumor Necrosis Factor bet 1 mililiter 1061 € MBS Polyclonals_1 human
abx167342 Anti-Tumor Necrosis Factor Ligand Superfamily, Member 12 Protein (Recombinant) 10 μg 412 € abbex human
abx166323 Anti-Tumor Necrosis Factor Ligand Superfamily, Member 13 Protein (Recombinant) 100 μg 949 € abbex human
abx167016 Anti-Tumor Necrosis Factor Ligand Superfamily, Member 9 Protein (Recombinant) 100 μg 862 € abbex human
abx167438 Anti-Tumor Necrosis Factor Ligand Superfamily, Member 9 Protein (Recombinant) 100 μg 891 € abbex human
CA72 Recombinant Human Transforming Growth Factor β-1, TGFB1 (N-8His) 500 µg 1328 € novo human
MBS612868 APRIL, ED2 (a Proliferation Inducing Ligand, TALL-2, TNF and ApoL-related Leukocyte-expressed Ligand 2, TRDL-1a, TNF-related Death Ligand 1a, TNFSF13) Antibody 100ug 569 € MBS Polyclonals_1 human
CM20 Recombinant Carassius Auratus Leptin (N-8His) 500 µg 1613 € novo human
C688 Recombinant Human Dickkopf-Related Protein 1, DKK1 (N-8His) 10 µg 202 € novo human
CS40 Recombinant Human Fc epsilon RII, CD23 (N-8His) 500 µg 1613 € novo human
CP84 Recombinant Human Fibrillin-1, Asprosin (N-8His) 50 µg 496 € novo human
CM21 Recombinant Human Isocitrate Dehydrogenase 1, IDH1 (C-8His) 50 µg 496 € novo human
CM34 Recombinant Human Isocitrate Dehydrogenase 1, IDH1 (R132H, C-8His) 1 mg 2283 € novo human
CB20 Recombinant Human NKG2-A, NKG2-B Type II Integral Membrane Protein(N-8His) 50 µg 141 € novo human
CS55 Recombinant Human NKG2A & CD94 Heterodimer (N-8His & N-Flag) 500 µg 1186 € novo human
C018 Recombinant Human Noggin, NOG (N-8His-Flag) 10 µg 156 € novo human
CB42 Recombinant Human Parathyroid Hormone, PTH (N-8His) 10 µg 126 € novo human
CP01 Recombinant Human Serum Albumin, HSA (C-8His) 50 µg 141 € novo human
C773 Recombinant Mouse Dickkopf-Related Protein 1, mDKK1, DKK-1 (N-8His) 500 µg 1613 € novo mouse
CC27 Recombinant Mouse Fibrillin-1, Asprosin (N-8His) 10 µg 202 € novo mouse
abx252569 Anti-Human Tumor necrosis factor ligand superfamily member 4 ELISA Kit inquire 50 € abbex human
abx190082 Anti-Human Tumor Necrosis Factor Related Apoptosis Inducing Ligand CLIA Kit 96 tests 1079 € abbex human
abx253490 Anti-Human Tumor Necrosis Factor Related Apoptosis Inducing Ligand ELISA Kit inquire 50 € abbex human