| Reacts with: |
Rabbit |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Rabbit T-lymphocyte Activation Antigen CD82 is produced by our Mammalian expression system and the target gene encoding Gly33-Gln241 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
24, 5 kD |
| UniProt number: |
P42070 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
GISQVTKSVKEMAALSCDYNISIDELARMRIYWQKDQQMVLSIISGQVEVWPEYKNRTFPDIINNLSLMILALRLSDKGTYTCVVQKNENGSFRREHLTSVTLSIRADFPVPSITDIGHPDPNVKRIRCSASGGFPEPRLAWMEDGEELNAVNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPIDQHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| About: |
Anti-human, Rabbit antibodies are very stable and can be stored for several days at room temperature, anti mouse antibodies to highly immunogenic selected peptide sequences are", monoclonal like", novo adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies, since the epitope to which they are directed is less than 35 amino acids long, Rabbits are used for polyclonal antibody production by novo |
| Latin name: |
Oryctolagus cuniculus |
| Group: |
recombinants |
| Gene target: |
CD80 (C-6His), B7-1 |
| Short name: |
CD80 (C-6His), Recombinant Rabbit B7-1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Host: |
Rabbits, Rabbit |
| Alternative name: |
CD80 molecule (C-6His), recombinant production species: rabbit B7-1 |
| Alternative technique: |
rec |
| Alternative to gene target: |
B7 and B7-1 and B7, BT, CD80 and IDBG-51287 and ENSG00000121594 and 941, Cd80 and IDBG-160288 and ENSMUSG00000075122 and 12519, Cell surfaces, DNA-templated and biological process this GO :0046641 and positive regulation of alpha-beta T cell proliferation and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process, coreceptor activity, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0007173 and epidermal growth factor receptor signaling pathway and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008543 and fibroblast growth factor receptor signaling pathway and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009967 and positive regulation of signal transduction and biological process this GO :0009986 and cell surface and cellular component this GO :0015026 and coreceptor activity and molecular function this GO :0016021 and integral component of membrane and cellular component this GO :0016032 and viral process and biological process this GO :0031295 and T cell costimulation and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0038095 and Fc-epsilon receptor signaling pathway and biological process this GO :0042102 and positive regulation of T cell proliferation and biological process this GO :0042110 and T cell activation and biological process this GO :0045086 and positive regulation of interleukin-2 biosynthetic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045425 and positive regulation of granulocyte macrophage colony-stimulating factor biosynthetic process and biological process this GO :0045627 and positive regulation of T-helper 1 cell differentiation and biological process this GO :0045893 and positive regulation of transcription, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0015026 : coreceptor activity, this GO :0015026 : coreceptor activity, 1 and BB1 and CD28LG and CD28LG1 and LAB7, 27986 and IDBG-632750 and ENSBTAG00000018059 and 407131, CD80 molecule |
| Identity: |
1700 |
| Gene: |
CD80 |
More about : CD80 |
| Long gene name: |
CD80 molecule |
| Synonyms gene: |
CD28LG CD28LG1 |
| Synonyms gene name: |
B7-1 antigen) CD80 molecule , CD80 antigen (CD28 antigen ligand 1 |
| Synonyms: |
B7, 1 B7-1 |
| Synonyms name: |
B-lymphocyte activation antigen B7 |
| Locus: |
3q13, 33 |
| Discovery year: |
1993-12-14 |
| Entrez gene record: |
941 |
| Pubmed identfication: |
1370389 |
| RefSeq identity: |
NM_005191 |
| Classification: |
C2-set domain containing CD molecules V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000159419 |