| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Leukocyte Immunoglobulin-like Receptor Subfamily B Member 5 is produced by our Mammalian expression system and the target gene encoding Gly24-His456 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
47, 8 kD |
| UniProt number: |
O75023 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
GTLPKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATGFYAEPTLLALPSPVVASGGNVTLQCDTLDGLLTFVLVEEEQKLPRTLYSQKLPKGPSQALFPVGPVTPSCRWRFRCYYYYRKNPQVWSNPSDLLEILVPGVSRKPSLLIPQGSVVARGGSLTLQCRSDVGYDIFVLYKEGEHDLVQGSGQQPQAGLSQANFTLGPVSRSHGGQYRCYGAHNLSPRWSAPSDPLDILIAGLIPDIPALSVQPGPKVASGENVTLLCQSWHQIDTFFLTKEGAAHPPLCLKSKYQSYRHQAEFSMSPVTSAQGGTYRCYSAIRSYPYLLSSPSYPQELVVSGPSGDPSLSPTGSTPTPGPEDQPLTPTGLDPQSGLGRHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD85c, LIR-8 (C-6His), LILRB5 |
| Short name: |
CD85c, LIR-8 (C-6His), Recombinant LILRB5 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD85c, LIR-8 (C-6His), member 5, sapiens leukocyte immunoglobulin-like receptor, subfamily B (including TM and ITIM domains), recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD85C and LIR-8 and LIR8, LILRB5 and IDBG-68391 and ENSG00000105609 and 10990, Plasma membranes, member 5, protein binding, subfamily B (with TM and ITIM domains), this GO :0002376 and immune system process and biological process this GO :0004888 and transmembrane signaling receptor activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0006952 and defense response and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0016021 and integral component of membrane and cellular component, this GO :0004888 : transmembrane signaling receptor activity, this GO :0004888 : transmembrane signaling receptor activity and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, leukocyte immunoglobulin-like receptor |
| Identity: |
6609 |
| Gene: |
LILRB5 |
More about : LILRB5 |
| Long gene name: |
leukocyte immunoglobulin like receptor B5 |
| Synonyms gene name: |
leukocyte immunoglobulin-like receptor, member 5 , subfamily B (with TM and ITIM domains) |
| Synonyms: |
LIR-8 LIR8 CD85c |
| Synonyms name: |
leucocyte Ig-like receptor B5 |
| Locus: |
19q13, 4 |
| Discovery year: |
2000-01-11 |
| GenBank acession: |
AF025534 |
| Pubmed identfication: |
9548455 |
| Classification: |
Inhibitory leukocyte immunoglobulin like receptors CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000066636 |