Recombinant Cynomolgus Fibroblast Growth Factor 21, FGF-21 (C-6His)

Contact us
Catalog number: CS24
Price: 202 €
Supplier: novo
Product name: Recombinant Cynomolgus Fibroblast Growth Factor 21, FGF-21 (C-6His)
Quantity: 10 µg
Other quantities: 1 mg 2283€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Cynomolgus Fibroblast Growth Factor 21 is produced by our Mammalian expression system and the target gene encoding His29-Ser209 is expressed with a 6His tag at the C-terminus
Molecular Weight: 2 kD, 20
UniProt number: 2, XM_005589811
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAAHQSPESLLQLKALKPGVIQILGVKTSRFLCQKPDGALYGSLHFDPEACSFRELLLENGYNVYQSEAHGLPLHLPGNKSPHRDPASQGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQARSPSYASHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Group: recombinants
Gene target: FGF-21 (C-6His), Cynomolgus Fibroblast Growth Factor 21
Short name: FGF-21 (C-6His), Recombinant Cynomolgus Fibroblast Growth Factor 21
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Alternative name: FGF-21 (C-6His), recombinant Cynomolgus Fibroblast Growth Factor 21
Alternative technique: rec

Related Products :

MBS624077 Fibroblast Growth Factor, Acidic (FGF Acidic, FGFa, aFGF, FGF alpha, Fibroblast Growth Factor 1, FGF1, AFGF, Beta Endothelial Cell Growth Factor alpha, ECGFA, Endothelial Cell Growth Factor beta, ECGF-beta, ECGFB, ECGF, GLIO703, Heparin-binding Growth Fac Antibody 100ug 531 € MBS Polyclonals_1 human
MBS624298 Fibroblast Growth Factor, Basic (FGF Basic, FGFb, BFGF, Fibroblast Growth Factor 2, FGF2, Heparin-binding Growth Factor 2, HBGF-2, Prostatropin) (Biotin) Antibody 50ug 763 € MBS Polyclonals_1 human
CS24 Recombinant Cynomolgus Fibroblast Growth Factor 21, FGF-21 (C-6His) 50 µg 369 € novo human
MBS623388 Fibroblast Growth Factor, Basic (FGFb, BFGF, Fibroblast Growth Factor 2, FGF2, Heparin-binding Growth Factor 2, HBGF-2) Antibody 100ug 652 € MBS Polyclonals_1 human
MBS624013 Fibroblast Growth Factor, Basic (FGFb, BFGF, Fibroblast Growth Factor 2, FGF2, Heparin-binding Growth Factor 2, HBGF-2) Antibody 100ul 696 € MBS Polyclonals_1 human
C996 Recombinant Human Fibroblast Growth Factor 17, FGF-17 (C-6His) 1 mg 2283 € novo human
CG74 Recombinant Human Fibroblast Growth Factor 19, FGF-19 (N-6His) 1 mg 2283 € novo human
C223 Recombinant Human Fibroblast Growth Factor 21, FGF-21 (N-6His) 500 µg 1613 € novo human
CA19 Recombinant Human Fibroblast Growth Factor 23, FGF-23 (C-6His) 10 µg 202 € novo human
CM88 Recombinant Human Fibroblast Growth Factor 7, FGF-7, KGF (C-6His) 10 µg 202 € novo human
CK13 Recombinant Human Fibroblast Growth Factor 8, FGF-8a (N-6His) 10 µg 141 € novo human
CK14 Recombinant Human Fibroblast Growth Factor 8, FGF-8e (N-6His) 50 µg 369 € novo human
CK12 Recombinant Human Fibroblast Growth Factor 8, FGF-8F (N-6His) 10 µg 156 € novo human
CR04 Recombinant Mouse Fibroblast Growth Factor 17, FGF-17 (C-6His) 500 µg 1613 € novo mouse
CR12 Recombinant Mouse Fibroblast Growth Factor 9, FGF-9(C-6His) 1 mg 1877 € novo mouse
MBS611950 Nerve Growth Factor, beta (NGF, Beta Nerve Growth Factor, Beta Nerve Growth Factor Precursor, Beta NGF, HSAN5, Nerve Growth Factor beta, Nerve Growth Factor beta Polypeptide, Nerve Growth Factor beta Subunit, NGFB) 500ug 652 € MBS Polyclonals_1 human
MBS624653 Keratinocyte Growth Factor (KGF, Fibroblast Growth Factor 7, FGF-7) Antibody 100ug 464 € MBS Polyclonals_1 human
MBS623813 Fibroblast Growth Factor, Acidic (FGFa, aFGF, Fibroblast Growth Factor 1, FGF1, AFGF, ECGF, ECGF-beta, ECGFB, GLIO703, HBGF1) Antibody 100ul 1277 € MBS Polyclonals_1 human
GWB-D02951 Fibroblast Growth Factor-Basic human recombinant (rHu FGF-b)) 1 vial 3432 € genways human
GWB-AC2BB5 Fibroblast Growth Factor (FGF-4) recombinant 1 vial 579 € genways human
CH53 Recombinant Human Fibroblast Growth Factor 1, FGF-1, FGFa (Ala2-Asp155) 500 µg 1613 € novo human
C049 Recombinant Human Fibroblast Growth Factor 1, FGF-1, FGFa (Phe16-Asp155) 10 µg 100 € novo human
C222 Recombinant Human Fibroblast Growth Factor 12, FGF-12 500 µg 1613 € novo human
CG42 Recombinant Human Fibroblast Growth Factor 17, FGF-17 500 µg 1613 € novo human
C046 Recombinant Human Fibroblast Growth Factor 2, FGF-2, FGFb (Gly132-Ser288) 10 µg 100 € novo human
C751 Recombinant Human Fibroblast Growth Factor 2, FGF-2, FGFb (Met134-Ser288) 1 mg 2283 € novo human
C779 Recombinant Human Fibroblast Growth Factor 2, FGF-2, FGFb (Pro143-Ser288) 500 µg 1613 € novo human
CR08 Recombinant Human Fibroblast Growth Factor 4, FGF-4 50 µg 369 € novo human
C806 Recombinant Human Fibroblast Growth Factor 6, FGF-6 50 µg 369 € novo human
CH73 Recombinant Human Fibroblast Growth Factor 7, FGF-7, KGF 10 µg 202 € novo human