| Reacts with: |
Cynomologous monkey |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Cynomologous monkey T-lymphocyte Activation Antigen CD86 is produced by our Mammalian expression system and the target gene encoding Tyr31-Pro247 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
25, 7 kD |
| UniProt number: |
H9ZFI8 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
YFNETADLPCQFANSQNRSLSELVVFWQNQENLVLNEVYLGKEKFDSVHSKYMGRTSFDPESWTLRLHNLQIKDKGLYQCIIHHKRPTGMIRIHQMNSELSVLANFSQPEIVPISNITENMYINLTCSSIHGYPEPEKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCVLETDKTQLLSSPFSIELEDPQPPPDHIPHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Group: |
recombinants |
| Gene target: |
CD86 (C-6His), Cynomologous B7-2 |
| Short name: |
CD86 (C-6His), Recombinant Cynomologous B7-2 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Alternative name: |
CD86 molecule (C-6His), recombinant Cynomologous B7-2 |
| Alternative technique: |
rec |
| Alternative to gene target: |
B7-2 and B7, CD86 and IDBG-52336 and ENSG00000114013 and 942, CD86 and IDBG-633264 and ENSBTAG00000013118 and 414345, Cd86 and IDBG-158071 and ENSMUSG00000022901 and 12524, Cell surfaces, DNA-templated and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0051607 and defense response to virus and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :0071248 and cellular response to metal ion and biological process this GO :0071345 and cellular response to cytokine stimulus and biological process, coreceptor activity, this GO :0001878 and response to yeast and biological process this GO :0002224 and toll-like receptor signaling pathway and biological process this GO :0002309 and T cell proliferation involved in immune response and biological process this GO :0002668 and negative regulation of T cell anergy and biological process this GO :0004872 and receptor activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0007173 and epidermal growth factor receptor signaling pathway and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0007568 and aging and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008543 and fibroblast growth factor receptor signaling pathway and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009986 and cell surface and cellular component this GO :0015026 and coreceptor activity and molecular function this GO :0016021 and integral component of membrane and cellular component this GO :0016032 and viral process and biological process this GO :0031295 and T cell costimulation and biological process this GO :0032496 and response to lipopolysaccharide and biological process this GO :0034341 and response to interferon-gamma and biological process this GO :0038095 and Fc-epsilon receptor signaling pathway and biological process this GO :0042102 and positive regulation of T cell proliferation and biological process this GO :0042104 and positive regulation of activated T cell proliferation and biological process this GO :0042110 and T cell activation and biological process this GO :0042113 and B cell activation and biological process this GO :0042493 and response to drug and biological process this GO :0043011 and myeloid dendritic cell differentiation and biological process this GO :0043017 and positive regulation of lymphotoxin A biosynthetic process and biological process this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0045086 and positive regulation of interleukin-2 biosynthetic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045404 and positive regulation of interleukin-4 biosynthetic process and biological process this GO :0045630 and positive regulation of T-helper 2 cell differentiation and biological process this GO :0045893 and positive regulation of transcription, this GO :0004872 : receptor activity, this GO :0004872 : receptor activity and also this GO :0005102 : receptor binding and also this GO :0005515 : protein binding and also this GO :0015026 : coreceptor activity, this GO :0005102 : receptor binding, this GO :0005515 : protein binding, this GO :0015026 : coreceptor activity, 2 and B70 and CD28LG2 and LAB72, CD86 molecule |
| Identity: |
1705 |
| Gene: |
CD86 |
More about : CD86 |
| Long gene name: |
CD86 molecule |
| Synonyms gene: |
CD28LG2 |
| Synonyms gene name: |
B7-2 antigen) , CD86 antigen (CD28 antigen ligand 2 |
| Synonyms: |
B7, 2 B7-2 |
| Synonyms name: |
B-lymphocyte antigen B7-2 |
| Locus: |
3q13, 33 |
| Discovery year: |
1994-12-07 |
| Entrez gene record: |
942 |
| Pubmed identfication: |
7513726 |
| RefSeq identity: |
NM_006889 |
| Classification: |
Immunoglobulin like domain containing CD molecules V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000159482 |